KEGG   Acinetobacter sp. DUT-2: A0J50_01405Help
Entry
A0J50_01405       CDS       T04353                                 

Definition
(GenBank) ribonuclease BN
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
acw  Acinetobacter sp. DUT-2
Brite
KEGG Orthology (KO) [BR:acw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:acw03009]
    A0J50_01405
Enzymes [BR:acw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A0J50_01405
Ribosome biogenesis [BR:acw03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A0J50_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_32 Ubie_methyltran PCMT MTS TPMT Methyltransf_9 Methyltransf_12 Methyltransf_4 NodS tRNA_U5-meth_tr Methyltransf_18 Methyltransf_8 PrmA Methyltransf_29 DREV Birna_VP3 Pox_MCEL BILBO1_N
Motif
Other DBs
NCBI-ProteinID: AMO42315
UniProt: A0A127KKF1
Position
299203..300009
Genome map
AA seq 268 aa AA seqDB search
MCPVCRQSLNLIERTWRCEQEHSYDVAKQGYVNLHVVQHKHSKNPGDTPESVDARRAFLQ
GGYYQPLQQAVVALLKQLDVKAILDIGCGEGYYTSAMQQVVEQCVGVDIAKNAVQRAAKL
NTEVTWVVGTGATLPVLDHSMDACTSLFSPIPQTEIARVLKDEGYLIVVTPASEHLYAMR
EALFEQVNPHTPEKFVEQLQDLFELKQEQIIDAPFVLDQQALKNLIAMTPYAYKASPERR
LQLEQQLQLEVTASFQIYVFQKRNKKAI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctgtatgtcgtcagtccctcaatttaattgaacgaacttggcgatgtgagcaa
gaacatagttatgatgtagctaaacaaggctatgtcaatttacatgtggtgcaacataaa
catagtaaaaacccaggggatacacccgagtcagtagatgcgcgacgagcttttttgcaa
ggtggttattatcagccattacagcaagctgtagtcgctttattaaagcagctagatgta
aaagcaatactcgatatcggatgtggtgaaggctactatacaagtgccatgcagcaagtc
gttgagcagtgtgttggtgttgatattgcaaaaaatgcggtacagcgggcagcaaagctc
aacactgaagtaacttgggtggtgggaacaggggcgactttaccagtgctagaccatagc
atggatgcctgcaccagtttatttagcccgattccgcaaacagaaattgcacgtgtttta
aaagatgagggctatttaattgttgttacgcctgcttctgaacatttgtatgcaatgcgt
gaggctttatttgagcaagttaatcctcacacaccagaaaagtttgtagagcaactacaa
gatttgtttgaattaaagcaagagcaaattattgatgcgccttttgtgctcgatcaacaa
gccttaaaaaatctgattgctatgacaccttatgcttataaagcttctcctgagcgtcgc
ttgcagttagagcagcaattgcaattagaagtaacggcatcatttcaaatttatgtcttt
cagaagcgcaataaaaaagccatctaa

DBGET integrated database retrieval system