KEGG   Acinetobacter sp. DUT-2: A0J50_04390Help
Entry
A0J50_04390       CDS       T04353                                 

Definition
(GenBank) fructose-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
acw  Acinetobacter sp. DUT-2
Pathway
acw00010  Glycolysis / Gluconeogenesis
acw00030  Pentose phosphate pathway
acw00051  Fructose and mannose metabolism
acw00680  Methane metabolism
acw01100  Metabolic pathways
acw01110  Biosynthesis of secondary metabolites
acw01120  Microbial metabolism in diverse environments
acw01130  Biosynthesis of antibiotics
acw01200  Carbon metabolism
Module
acw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0J50_04390
   00030 Pentose phosphate pathway
    A0J50_04390
   00051 Fructose and mannose metabolism
    A0J50_04390
  09102 Energy metabolism
   00680 Methane metabolism
    A0J50_04390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acw04147]
    A0J50_04390
Enzymes [BR:acw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     A0J50_04390
Exosome [BR:acw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A0J50_04390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AMO39977
UniProt: A0A127KDN1
Position
complement(919229..920200)
Genome map
AA seq 323 aa AA seqDB search
MSNLTLSQFLQQQKGNLTPELAQVIDTIATTCKTIDQALQKGALAGILGSAGNENVQGET
QKKLDVISNDYLIDALKVHPHVGGLASEELDEFTPAQENGKYLVLFDPLDGSSNIDINMC
VGTIFSILPAKNAVTQANDFMQAGTQQVAAGYVLYGPSTMMALTVGNGVAFFTLDPETQT
FLLTNENVQVPADTQEFAINASNQRHWEQPVKQYIDELLAGKTSVREKDFNMRWVACMVG
DIHRILCRSGIFLYPYDLKDPKKAGRLRLMYEANPMSMLIEQAGGASTTGRVRILEIEPT
ELHQRVPVIIGSKNEVERVTSYH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacctcactttgtcccaatttttacaacaacaaaaagggaatctaacacctgag
ttggctcaagtcatcgatactattgccacgacctgtaaaacaatcgaccaagcattacaa
aaaggtgctctagctggtattttaggtagtgctggcaatgaaaatgttcagggtgaaaca
cagaaaaaacttgatgtgatttcgaatgactatttaattgatgctttaaaagtacacccg
cacgtaggcggtctcgcttctgaagagcttgatgagttcacacctgcacaagaaaatggt
aaatacctcgttttatttgatccattagatggctcaagcaatatcgatatcaatatgtgt
gtaggtacgattttctctattttgcctgcaaaaaatgcagtaacacaagcaaacgatttc
atgcaagctggcacacagcaagttgctgctggttatgtactttatggcccatcaactatg
atggctttaactgtaggaaatggcgtagcattctttactttagatccagaaactcaaacc
ttcttgcttactaatgagaatgtccaagttccagcagacactcaagaattcgctattaat
gcatctaaccagcgtcattgggaacaaccagtaaaacaatatattgatgaattactcgca
ggcaagacatctgttcgtgaaaaagatttcaatatgcgctgggtagcatgtatggtgggt
gatattcaccgtattttatgtcgtagtggtattttcctttacccatatgacttgaaagat
ccgaaaaaagcaggtcgtttacgtttaatgtatgaagcgaatccaatgagtatgctcatt
gaacaagcaggcggtgcatcaactactggccgtgtacgcattctagagattgaacctaca
gaacttcaccaacgtgtacctgtaatcattggttctaaaaatgaagttgaacgcgtaaca
agctaccactaa

DBGET integrated database retrieval system