KEGG   Acinetobacter sp. DUT-2: A0J50_06950Help
Entry
A0J50_06950       CDS       T04353                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
acw  Acinetobacter sp. DUT-2
Pathway
acw00010  Glycolysis / Gluconeogenesis
acw00071  Fatty acid degradation
acw00350  Tyrosine metabolism
acw00625  Chloroalkane and chloroalkene degradation
acw00626  Naphthalene degradation
acw01100  Metabolic pathways
acw01110  Biosynthesis of secondary metabolites
acw01120  Microbial metabolism in diverse environments
acw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0J50_06950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0J50_06950
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A0J50_06950
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A0J50_06950
   00626 Naphthalene degradation
    A0J50_06950
Enzymes [BR:acw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A0J50_06950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK
Motif
Other DBs
NCBI-ProteinID: AMO40410
UniProt: A0A127KEX8
Position
complement(1478180..1479337)
Genome map
AA seq 385 aa AA seqDB search
MSHFQFQTVPNIISGLGSIQELQNVFSSKAYRKLLLVTDAGMVKNQLHRPILQILDNLNI
EYVIYADVQADPPEQVVLDAANYAKQQNVDAIIGFGGGSSLDVAKVIALLAHPNQTQSLQ
EMYGVNQVTTARLPLILIPTTAGTGSEVTPISIVTTGETTKMGIVSPVLYADTAILDATF
TQNLPAHITAATGIDAMVHAIEAYTSKHKKNIYTDILAKNALKLLNHNLPKVLKDGNNLE
ARQNMLFGSMLAGQAFANSPVAAVHALAYPLGGHFHLSHGHTNALVLVEVLKFNAPNAKK
YYAELMQWLDPYSNGSTDGLCDLFIDHMQNHLDRSGLTLKLRDLGIDELSLPRLAQDAML
QTRLLQNNPRDMTEAAALAIYQAIH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagccattttcaatttcaaactgttccaaatatcatctctggcttaggctctatacaa
gaattacaaaatgttttttcgtcaaaagcttaccgtaagttattgctagtcaccgatgca
ggcatggttaaaaatcaattacaccgtcccattctgcaaattttagataacctcaatatt
gaatatgtcatctatgccgatgtgcaagctgatccgcctgaacaagtagtactagatgca
gccaattatgcaaaacagcaaaatgttgatgccattattggttttggtggtggtagttct
ctagatgttgcaaaagttattgctttactcgcccaccctaaccagacccaaagtttgcaa
gagatgtacggcgtgaatcaggtcactacagctcgtcttccgcttattttgattcctact
acagctggtacaggctcagaagtaacgccaatctcaattgtcactacaggtgagacgaca
aagatggggattgtctctccagtactatacgccgacactgcaattcttgatgctactttt
actcaaaaccttccagcacatattaccgctgcaacaggtatcgatgcgatggtacatgcc
attgaggcatatacttctaaacacaagaagaatatatacaccgatattttagctaagaat
gctttgaagctactaaaccataacttaccgaaagttcttaaagatggtaataatttagaa
gcacgtcaaaacatgctgttcggttcaatgctagcaggtcaagcatttgcaaactcgcct
gttgccgctgtacatgctttagcttacccattgggcggtcattttcatttatcgcatggg
cataccaatgcgttagtgttggttgaagtattaaaatttaatgcgcccaatgcaaaaaaa
tactatgcagagcttatgcaatggctcgatccatacagcaatggcagcactgatggcttg
tgtgatttatttattgaccatatgcagaaccacttagaccgtagtggcttgaccttaaaa
cttagagatttgggtattgatgagttgagcttacctcggcttgctcaagatgctatgttg
caaactcgcttactacaaaataacccacgagacatgacagaagccgctgctttggctatt
tatcaggcgattcattaa

DBGET integrated database retrieval system