KEGG   Acinetobacter sp. DUT-2: A0J50_10730Help
Entry
A0J50_10730       CDS       T04353                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acw  Acinetobacter sp. DUT-2
Pathway
acw00071  Fatty acid degradation
acw00072  Synthesis and degradation of ketone bodies
acw00280  Valine, leucine and isoleucine degradation
acw00310  Lysine degradation
acw00362  Benzoate degradation
acw00380  Tryptophan metabolism
acw00620  Pyruvate metabolism
acw00630  Glyoxylate and dicarboxylate metabolism
acw00640  Propanoate metabolism
acw00650  Butanoate metabolism
acw00900  Terpenoid backbone biosynthesis
acw01100  Metabolic pathways
acw01110  Biosynthesis of secondary metabolites
acw01120  Microbial metabolism in diverse environments
acw01130  Biosynthesis of antibiotics
acw01200  Carbon metabolism
acw01212  Fatty acid metabolism
acw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0J50_10730
   00630 Glyoxylate and dicarboxylate metabolism
    A0J50_10730
   00640 Propanoate metabolism
    A0J50_10730
   00650 Butanoate metabolism
    A0J50_10730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0J50_10730
   00072 Synthesis and degradation of ketone bodies
    A0J50_10730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A0J50_10730
   00310 Lysine degradation
    A0J50_10730
   00380 Tryptophan metabolism
    A0J50_10730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A0J50_10730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A0J50_10730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A0J50_10730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acw04147]
    A0J50_10730
Enzymes [BR:acw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A0J50_10730
Exosome [BR:acw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A0J50_10730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AMO41074
UniProt: A0A127KGL2
Position
2284657..2285862
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAADFGISREQA
DLFAAQSQAKYQKAKEEGFFADEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLSLTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacgcatatatctatgatggtttacgtagtccatttggccgtcatgcgggtgaa
cttgcctcaattcgccctgatgatttagcagcaaccgttattcaaaaattacttgaaaaa
acaggtgtaccaggcgcggatattgaagatgtgattttaggcgacaccaaccaagcgggt
gaagatagtcgtaatgtggcacgaaatgcactattgcttgccggtttacctgtcactgtg
ccgggccaaacggtaaaccgcctatgtgctagtggtttaggtgctgtgattgactcggca
cgtgccattacttgtggtgaaggtgaactgtatattgcaggtggtgtagaaagtatgtca
cgtgctccctttgtgatgggtaaagcagaaagtgcttatagccgtgatgcaaaaatttat
gacaccaccattggctctcgctttccaaataaaaaaattattgctcagtacggcggacat
tcaatgcctgaaacaggtgataacgttgcagccgattttgggattagccgtgagcaagca
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gccgatgaaattaccccaattgaggttttccaaggcaaaaaattaccgcctaaactcgtt
tctgaagatgaacaccctcgtccaagctcaactgttgaagcgctcacaaagttaaaaccg
ctatttgaaggcggcgttgtcactgctggtaatgcctccgggattaatgacggtgcagca
gcacttttgattggttctgaagcggcaggtcaaaaatatggcttaaaaccaatggctaaa
attttgtcagcagcagctgcgggtattgagccacgcattatgggtgcaggtccgatcgaa
gccattaaaaaagctgttgcgcgtgctggccttactttagatgacatggacattatcgaa
attaatgaagcctttgcttcacaagttttatcttgtttaaaaggtttaaatgttgatttt
aatgacccgcgtgtgaacccgaacggtggtgcgattgctgttggtcatccacttggtgca
tctggtgctcgtcttagcttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcctatgtattggtgtaggtcaaggtcttgcgatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system