KEGG   Acinetobacter sp. DUT-2: A0J50_12185Help
Entry
A0J50_12185       CDS       T04353                                 

Definition
(GenBank) NADH pyrophosphatase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
acw  Acinetobacter sp. DUT-2
Pathway
acw00760  Nicotinate and nicotinamide metabolism
acw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A0J50_12185
Enzymes [BR:acw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     A0J50_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase DZR RecR NUDIX-like zinc_ribbon_2 DUF1451 HypA A2L_zn_ribbon Nudix_N_2 OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: AMO41324
UniProt: A0A127KHA3
Position
2596162..2596905
Genome map
AA seq 247 aa AA seqDB search
MSELSLAYIFHHQQLLVDQNLQLPKVEKLASDLLFTHDEQVIARDLLAEEPIPEGLQLVP
IRQLITSWSKEQFLQASRAVQLLEWRRNHKFCSHCGHPTEVHPTEYAMVCPSCRYHQYPR
VNPCIITVITRGDDEILLAKSVHNKTNMYGLIAGFVEVGETLEEAVQREAFEEVGLKLKN
IQYMSSQPWPFPSNLMVAFRAEYESGEIKLQEEEIADAQFFKIDQLPEIPFKGSIAHSMI
MQITQAG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattatcacttgcttatattttccatcatcaacaattactggttgaccagaat
ctccaactacccaaagtcgaaaagttagcaagtgatttacttttcactcatgatgagcaa
gtcattgcacgtgacttgcttgctgaggaacctatccccgaaggcttacagcttgttcca
attcgccagcttattaccagctggtcgaaagaacagtttttgcaagcaagccgtgctgtt
caattacttgaatggcgacgtaaccataagttttgtagtcactgtggacatccgacagaa
gttcatccaaccgaatatgcaatggtatgcccttcctgtcgctaccaccaatatcctcgt
gtaaacccttgcattattaccgtcattactcgtggtgatgatgaaatcttgctggctaag
tcagttcacaacaaaaccaatatgtatggtttgattgcaggttttgttgaggtgggcgaa
acacttgaagaggcagtacaacgtgaagcctttgaagaagtaggtttaaaactcaaaaat
attcagtatatgtcaagtcagccttggccattcccaagtaaccttatggtggcatttcgg
gcagaatatgagtcgggtgaaattaagcttcaagaagaagaaattgcagatgcacaattc
ttcaaaattgatcaattacctgagattccgtttaaaggaagtattgctcattcaatgatt
atgcagattacccaagctgggtaa

DBGET integrated database retrieval system