KEGG   Azotobacter chroococcum: Achr_11110Help
Entry
Achr_11110        CDS       T03640                                 

Gene name
rrmA
Definition
(GenBank) rRNA (Guanine-N(1)-)-methyltransferase (Ribosomal RNA large subunit methyltransferase A)
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
acx  Azotobacter chroococcum
Brite
KEGG Orthology (KO) [BR:acx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:acx03009]
    Achr_11110 (rrmA)
Enzymes [BR:acx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Achr_11110 (rrmA)
Ribosome biogenesis [BR:acx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Achr_11110 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS Methyltransf_32 Methyltransf_4 Ubie_methyltran Methyltransf_18 Methyltransf_33 MetW Methyltransf_2 PCMT OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: AJE20592
UniProt: A0A0C4WQP5
Position
complement(1223363..1224166)
Genome map
AA seq 267 aa AA seqDB search
MLTCPLCNGTLSADDRGVACPAGHRFDRARQGYLNLLPVQHKKSRDPGDNQAMVEARRRF
LDGGHYAPLARRLTELAAERAPRRWLDIGCGEGYYTAQLAEALPEADGYALDISREAVKR
ACRRAPQLTWLVASMARVPLADASCDLLASVFSPLDWQEARRLLAPGGGLLRMGPTREHL
LELRGLLYDEVREYDDAKHLSLIPPGMHLAHSETLSYRLRLDNAEDRADLLAMTPHGWRA
NAERRAAVIAAPLEVTIAIRYDWIERN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgctgacctgtccgctctgcaacggcaccctgagcgccgacgaccgtggcgtcgcctgc
cccgccgggcaccgcttcgaccgcgcccgccagggctacctgaacctgttgccagtgcag
cacaagaagagccgcgaccccggcgacaaccaggcaatggtcgaagcgcgccggcgcttc
ctcgacggcgggcactacgccccgctggcccgccggctgaccgaactggccgccgaacgc
gcgccacgccgctggctggacatcggctgcggcgagggctactacaccgcgcaactggcc
gaagccctgcccgaggccgacggctacgccctggacatctcccgcgaggcggtcaagcgg
gcctgccgcagggccccgcagctgacctggctggtcgccagcatggcccgggtgccgctg
gccgacgccagctgcgacctgctggccagcgtgttcagcccgctcgactggcaggaggcc
cggcgcctgctggcccccggcggcggcctgctgcgcatggggccgacccgcgagcacctg
ctggaactgcgcggcctgctctacgacgaggtgcgcgagtacgacgacgccaagcacctg
tcgctgattccgccgggcatgcatctcgcgcacagcgaaacgctgagttaccggctgcgg
ctggacaacgccgaggaccgcgccgacctgctggcgatgaccccgcacggctggcgcgcc
aacgccgaacgccgcgccgcggtgatcgccgcgcccttagaggtcaccatcgccatacgc
tacgattggatcgaacgaaactag

DBGET integrated database retrieval system