KEGG   Azotobacter chroococcum: Achr_17640Help
Entry
Achr_17640        CDS       T03640                                 

Definition
(GenBank) Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
acx  Azotobacter chroococcum
Pathway
acx00061  Fatty acid biosynthesis
acx00071  Fatty acid degradation
acx01100  Metabolic pathways
acx01212  Fatty acid metabolism
acx02024  Quorum sensing
Module
acx_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Achr_17640
   00071 Fatty acid degradation
    Achr_17640
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_17640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acx01004]
    Achr_17640
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acx04147]
    Achr_17640
Enzymes [BR:acx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Achr_17640
Lipid biosynthesis proteins [BR:acx01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Achr_17640
Exosome [BR:acx04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Achr_17640
  Exosomal proteins of breast cancer cells
   Achr_17640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AJE21220
UniProt: A0A0C4WNV6
Position
1929625..1931328
Genome map
AA seq 567 aa AA seqDB search
MTETPWKDHHPAGLVRDIDPDLYPNIPAVLKASCQRFADRPAFSNLGHNLSYDELYALSG
AFAAFLQGLEGLQPGDRIAVQLPNLLQYPVVVFGALRAGLIVVNTNPLYTAREMLQQFED
SGAKALVCLANKAHLAEEVLPRSGIRHVVVTEVGDLLPPLRRVLVNGVVRYVKRMVPAYH
LPQALKFSAALATGRGRTLQEVEAAPGDVAVLQYTGGTTGTPKGAMLTHRNLVANMLQCR
ALVAGVLGEGCETLVAPLPLYHIYAFTLHCMAMMLLGNHNLLISDPRDLPGMVRELSKWK
FSGFVGLNTLFAALCHDEGFRRLDFSALKLTLSGGMALQQAVADCWKATTGCEILEGYGL
TETSPVVTGNPCGHIRPGTIGLPLASTLCQVRDDEGNELPPGSRGELWVKGPQVMKGYWQ
NPEATAAVLDADGWLRTGDIALIEPDGYLRIVDRKKDMILVSGFNVYPNELEEVLASLPG
VLQCAVIGVPDERTGEAIKVFVVVKPGATLTEEQVMRHMHDNLTGYKRPKHIEFRDRLPT
TNVGKILRRELRDQELRRTAGAERAGS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccccctggaaggaccatcaccccgccggcctcgtccgcgacatcgatccc
gacctgtaccccaacattcccgccgtgctgaaggcctcctgccagcgcttcgccgaccgg
ccggcgttcagcaacctcggccataacctcagctatgacgagctgtacgcgctgtccggc
gccttcgccgccttcctgcaggggctcgagggcctgcagccgggcgaccgcatcgccgtg
cagctgcccaaccttctgcagtacccggtggtggtgttcggcgccctgcgcgccgggctg
atcgtggtcaacaccaacccgctgtacaccgcccgggagatgctccagcagttcgaggat
tccggggccaaggccctggtctgcctggccaacaaggcccatctggccgaggaggtgctg
ccgcggagcggcatccggcacgtggtggtcaccgaggtcggcgacctgctgccgccgctc
aggcgcgtgctggtcaacggcgtggtgcgctacgtcaagcgcatggttccggcctaccac
ctgccgcaggcgctgaagttcagcgccgccctggccacaggccgcggccggacgctgcag
gaggtcgaggcggcgcccggcgatgtcgccgtgctgcagtacaccggcggcaccaccggc
acgcccaagggcgccatgctcacccaccgcaacctggtggccaacatgctgcagtgccgg
gcgctggtcgccggcgtcctcggcgagggctgcgagaccctggtcgcgccgctgccgctc
tatcacatctacgccttcaccctgcactgcatggcgatgatgctcctcggcaaccacaac
ctgctgatcagcgatccgcgcgacctgccgggcatggtccgcgagctgtcgaagtggaag
ttcagcggcttcgtcggcctcaacaccctgttcgccgcgctgtgccacgatgagggcttc
cgccgcctggacttctccgcgctgaagctgaccctgtccggcggcatggccctgcagcag
gccgtcgccgactgctggaaggccaccaccggctgcgagatcctcgaaggctacggtctc
accgaaaccagcccggtggtgaccggcaacccctgcgggcacatccgccccggcaccatc
ggcctgccgctggcctcgaccctctgccaggtgcgcgacgatgagggcaacgagctgccg
cccggcagccgtggcgagctctgggtgaagggcccgcaggtgatgaagggctactggcag
aaccccgaggccaccgccgcggtgctcgacgccgacggctggctgcgcaccggcgacatc
gcgctgatcgagcccgacggctacctgcgcatcgtcgaccgcaagaaggacatgattctg
gtgtccggcttcaacgtctatccgaacgagctggaggaggtcctcgccagcctgccgggg
gtgttgcagtgcgccgtcatcggcgtgcccgacgagcgcaccggcgaggccatcaaggtc
ttcgtggtggtcaagcctggcgcgaccctgaccgaggagcaggtgatgcgccacatgcac
gacaacctcaccggctacaagcgtccgaaacacatcgagttccgcgaccgcctgccgacc
accaacgtcggcaagatcctgcgccgcgagctgcgtgaccaggagctgcgccggacggcc
ggcgcggagcgggccggctcctga

DBGET integrated database retrieval system