KEGG   Azotobacter chroococcum: Achr_21950
Entry
Achr_21950        CDS       T03640                                 

Definition
(GenBank) 2-keto-D-gluconate dehydrogenase,membrane-bound, gamma subunit
Organism
acx  Azotobacter chroococcum
SSDB
Motif
Pfam: FAD-SLDH
Other DBs
NCBI-ProteinID: AJE21644
UniProt: A0A0C4WMM4
Position
2450130..2450654
AA seq 174 aa
MSKHASVPPGPAPVPAFTLSRRRLLGAACVGAATGALLLSPVAPVWAAAAAEAELSTFME
LSRRLTGRNDLDAKVGQSLHETLLKRDAGFAARLGELQGKLGKTPQGLNEKARDAARQIL
SAWYLGMVGSDYTATVVSYPDALMFKAAGGVIKPRAFCYGMPGSWAEKPGLGRA
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtccaaacatgcctccgtcccccccggcccagcgcccgtgcctgcgttcaccctttcc
cggcgccgtctgctcggcgcggcctgcgtcggcgccgccaccggcgccctgctgctgagc
ccggtcgccccggtctgggcggcagccgccgccgaagccgaactgtcgaccttcatggag
ctgtccaggcgcctcaccgggcgcaacgacctggatgccaaggtcggccagagtctccac
gaaaccctgctcaagcgtgatgccggcttcgccgcacgcctcggcgaactgcagggcaag
ctcggcaagaccccgcaaggcctgaacgaaaaagcccgggacgcggcccggcagatcctc
tccgcctggtatctcggcatggtcggcagcgactacaccgccacggtggtcagctacccg
gatgccctgatgttcaaggccgcgggcggcgtcatcaagccgcgggccttctgttacggc
atgcccggctcctgggccgagaagcctggcctcgggagagcttga

DBGET integrated database retrieval system