KEGG   Azotobacter chroococcum: Achr_22900Help
Entry
Achr_22900        CDS       T03640                                 

Gene name
phbA
Definition
(GenBank) 3-ketoacyl-CoA thiolase Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acx  Azotobacter chroococcum
Pathway
acx00071  Fatty acid degradation
acx00072  Synthesis and degradation of ketone bodies
acx00280  Valine, leucine and isoleucine degradation
acx00310  Lysine degradation
acx00362  Benzoate degradation
acx00380  Tryptophan metabolism
acx00620  Pyruvate metabolism
acx00630  Glyoxylate and dicarboxylate metabolism
acx00640  Propanoate metabolism
acx00650  Butanoate metabolism
acx00900  Terpenoid backbone biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01120  Microbial metabolism in diverse environments
acx01130  Biosynthesis of antibiotics
acx01200  Carbon metabolism
acx01212  Fatty acid metabolism
acx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Achr_22900 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    Achr_22900 (phbA)
   00640 Propanoate metabolism
    Achr_22900 (phbA)
   00650 Butanoate metabolism
    Achr_22900 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Achr_22900 (phbA)
   00072 Synthesis and degradation of ketone bodies
    Achr_22900 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Achr_22900 (phbA)
   00310 Lysine degradation
    Achr_22900 (phbA)
   00380 Tryptophan metabolism
    Achr_22900 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Achr_22900 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Achr_22900 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_22900 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acx04147]
    Achr_22900 (phbA)
Enzymes [BR:acx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Achr_22900 (phbA)
Exosome [BR:acx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Achr_22900 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJE21731
UniProt: A0A0C4WMT9
Position
2550171..2551349
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVAATRTAVGSFQGSLANIPAAELGAAVIRHLLEQTKLDAAQVDEVILGQVLTAG
VGQNPARQAVIKAGLPHTVPAMTLNKVCGSGLKALHLATQAIRCGDADVIIAGGQENMSL
SPYVLPGARTGLRMGHANLLDSMIQDGLWDAFNNYHMGITAENLVEKFGISREEQDALAA
ASQQKAVAAIEAGHFRSQITPISIPQRKGDPIVFDTDEQPRAETTLEALSKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSAEKAQSLGLPVLARIKAYANAAVDPAIMGIGPVSATRRC
LEKAGWSLDDLDLIEANEAFAAQSLSVGKELGWDASKVNVNGGAIAIGHPIGASGCRILV
TLVHEMIRRDLKKGLATLCIGGGQGVALAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtaatcgtcgctgcaacccggactgcagtaggcagcttccaagggtcc
ctggccaatattcccgcagcagaactgggcgcagctgtgatccgtcatctgcttgaacag
accaagctggatgccgcccaggtcgatgaggtaattttgggccaagtgctcactgctggt
gtaggacagaatccggcccgtcaggccgtgatcaaggcaggcctcccccacacagttccc
gccatgaccctaaacaaggtttgcggttctggactcaaggctttgcacttggccactcaa
gccatccgctgcggtgatgccgacgtgatcattgcaggcggccaggaaaacatgagcctt
tcgccctatgtccttcctggtgcccgcaccggtctgcgcatgggtcacgccaacctgctc
gacagcatgatccaagacggcctgtgggatgccttcaataattatcatatgggtatcacc
gcagagaatctcgtcgagaagttcggtatttcccgggaggaacaggatgcgcttgctgct
gcctctcagcaaaaggcagtagcagccatcgaagccggtcatttccgcagccagatcacc
cctatatcaattccccagcgcaagggagatccgattgttttcgacaccgacgaacagccg
cgtgccgagactactctcgaagctctgagcaaactcaagccggccttcaagaaagacggt
agcgtcactgcaggcaatgcctccagcctcaatgacggcgctgctgctgtgctgctgatg
agtgccgagaaagcccagtcgctcggcttgccggttctggcacgaatcaaggcctatgcc
aatgcggctgtcgatccggccatcatgggcatcggcccggtttcagccacccgccgctgc
ctggaaaaggcaggctggagcctggatgatctcgacctgatcgaagccaatgaggccttc
gcagcccaatccctgagtgttggcaaggagctggggtgggacgccagcaaggtcaatgtg
aatggcggtgccattgctatcggccaccccatcggagcctcaggctgtcgcattctggtc
acgctggtgcacgaaatgattagacgcgacctcaagaaaggcttggcaactctctgcatc
ggtggcgggcagggtgtagccctcgcagtggagcgttga

DBGET integrated database retrieval system