KEGG   Azotobacter chroococcum: Achr_34520Help
Entry
Achr_34520        CDS       T03640                                 

Gene name
ribB
Definition
(GenBank) Bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
acx  Azotobacter chroococcum
Pathway
acx00740  Riboflavin metabolism
acx00790  Folate biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
Module
acx_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Achr_34520 (ribB)
   00790 Folate biosynthesis
    Achr_34520 (ribB)
Enzymes [BR:acx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Achr_34520 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Achr_34520 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AJE22857
UniProt: A0A0C4WVS4
Position
complement(3856535..3857614)
Genome map
AA seq 359 aa AA seqDB search
MALNSIDELIEDIRQGKMVILMDDEDRENEGDLIMAAECVQAEHINFMAKYARGLICMPM
TRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAADRARTVQVAAAKNAQADD
IVSPGHIFPLMAQAGGVLARAGHTEAACDLARMAGFEPSGVICEIMNDDGSMARRPELED
FAEQHGIKIGTIADLIHYRLIHERTIQRIAEQELDSELGRFHLVSYRDAVEGDVHMALIM
GEIHADEPTLVRVHNMDPLRDLLMVRQPGRWSLRAAMAEVARAGRGVVLLLGHPLEANEV
LTLLREGTPKSPNTYSTVGAGSQILRDLGVRKMRLMSAPMKFNAISGFDLEVVEYLPAE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaacagcattgacgaactgatcgaagacatccgccagggcaagatggtcatc
ctcatggatgacgaggatcgcgagaacgagggtgatctgatcatggccgccgagtgcgtg
caggccgagcacatcaacttcatggcgaaatacgcccgcgggctgatctgcatgccgatg
acccgcgagcgctgcgagaccctcaagctgccgctgatggcgccgcgcaacggctccggt
ttcggcaccaagttcaccgtttccatcgaggcggccgagggcgtcaccaccggcatttcc
gccgccgaccgggcgcgtaccgtgcaggtcgccgcggcgaagaatgcccaggccgacgac
atcgtcagccccgggcacatctttccgctgatggcccaggcgggcggcgtgctggcccgc
gccgggcataccgaggcggcctgcgacctggcgcggatggccggcttcgagccttccggg
gtgatctgcgagatcatgaacgacgacggcagcatggcccgccgtcccgagctggaggac
ttcgccgagcagcacggcatcaagatcggcaccatcgccgacctgatccactaccggctg
atccacgagcgcaccatccagcgcatcgccgagcaggagctggacagcgaactgggccgc
ttccacctggtgagctaccgcgacgcggtggagggcgacgtgcacatggcgctgatcatg
ggcgagatccatgccgacgagccgaccctggtgcgggtgcacaacatggacccgctgcgc
gacctgctgatggtccgccagccgggccgctggagcctgcgcgcggcgatggccgaggtg
gcccgggccggccgtggcgtggtgctgctgctcggccatccgctggaggccaacgaggtg
ctgaccctgctgcgcgagggcacgcccaagtcgccgaacacctacagcaccgtcggtgcc
ggctcgcagatcctgcgcgacctcggcgtgcgcaagatgcgcctgatgagtgcgccgatg
aagttcaacgcgatatccgggttcgacctggaggttgtagaatacctgcccgccgaatga

DBGET integrated database retrieval system