KEGG   Azotobacter chroococcum: Achr_9350Help
Entry
Achr_9350         CDS       T03640                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
acx  Azotobacter chroococcum
Pathway
acx00480  Glutathione metabolism
acx00590  Arachidonic acid metabolism
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Achr_9350
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Achr_9350
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Achr_9350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA AHJR-like
Motif
Other DBs
NCBI-ProteinID: AJE20417
UniProt: A0A0C4WQ82
Position
1035458..1035940
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLSLRGLDGQDLPLAQFRDRVLLLVNVASRCGLTPQYAGLEKLHQQYRERGFSVL
GLPCNQFAGQEPGSEAQIREFCALNYGVTFPLAAKLEVNGPGRHPLYQLLAGEGAAFPGD
IGWNFEKFLVGRDGLVLARFSPRTAPDDPALLQAIEKALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgttccatgatctgtccttgcgcggactggacgggcaggacctgccgctggcg
cagttccgcgaccgggtgctgctgctggtcaacgtcgcctccaggtgtggcctgacgccc
cagtacgccggcctggagaagctccaccagcagtaccgcgagcgcggcttcagcgtgctc
ggcctgccgtgcaaccagttcgccgggcaggagccgggcagcgaggcacagatccgcgag
ttctgcgccctcaactacggtgtgaccttccccctggcggccaagctcgaggtcaacggc
cccggccgccatcccctgtaccagctgctggcgggggagggcgcggcgtttcccggcgac
atcggctggaatttcgagaagtttctcgtggggcgcgatggcctcgtgctggcgcgcttt
tcgccgcgcaccgcgccggacgatccggcgctgctgcaggcgatcgagaaggccctcggc
tga

DBGET integrated database retrieval system