KEGG   Azotobacter chroococcum: Achr_e170Help
Entry
Achr_e170         CDS       T03640                                 

Gene name
pitB
Definition
(GenBank) phosphate-transport permease PitB
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
acx  Azotobacter chroococcum
Brite
KEGG Orthology (KO) [BR:acx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Achr_e170 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF742 KELK
Motif
Other DBs
NCBI-ProteinID: AJE23611
UniProt: A0A0C4WSC4
Position
pAcX50e:complement(18573..20204)
Genome map
AA seq 543 aa AA seqDB search
MERVMSHHASSVNPTPAGPASLGVAGLSPLSLFFAIGFIAMTAYFMYWGLDYTNHSQVML
FILATLFGVFMAFNIGGNDVANSFGTSVGAGTLTIKQALLVAAVFEVSGAVIAGGEVTST
IRSGIVDLSGMAVTPMDFVYIMMSALVAAALWLLFATKKGYPVSTTHSIIGAIVGSSIIL
GVMLDGSESALALVQWGKIGEIAVSWVLSPLLGGLVSYLLFSLIKRHVLVYNDEMDQQLK
SLRQEKKTYKKQHKEAFERLSELQQIAYTHAMARDADVMSDHNFHPEDLESDYYRGLHAI
KQKRGEIDAHRALENWVPLIAALGAMIISSMLLFKGLKNMNLGLTTLHNYLIMGMIGAAV
WMATLIFAKTLKGESLDKSTFLIFSWMQVFTASGFAFSHGANDIANAIGPFAAILDVLRT
GEMGSQAAVPPLAMITFGVALIVGLWFIGKEVIQTVGTNLTEMHPASGFTAELAAAAVVM
LASLLGLPVSSTHILIGAVLGIGLVNRQNNWDLMKPIALAWVITLPAAAILSAIAFVVLR
SVF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggagagagtcatgtcccatcacgcttcgtcggtcaatccgacacccgccggcccggca
tcgctcggcgttgccggtctttcccccctcagtctgttcttcgccatcggctttatcgcg
atgaccgcctacttcatgtactgggggctcgactacaccaaccacagccaggtcatgctg
ttcatcctggcgacgctgttcggggtcttcatggccttcaacatcggcggcaacgatgtg
gccaactccttcggcaccagcgtcggcgcgggcaccctgaccatcaagcaggccctgctg
gtggcggcggtgttcgaggtgagcggcgcggtgatcgccggcggcgaggtcaccagcacc
atccgcagcggcatcgtcgacctgtccgggatggcggtgacgcccatggatttcgtctac
atcatgatgtcagcgctggtggccgcggcgctgtggctgctgttcgccaccaagaagggc
tacccggtctccaccacccactcgatcatcggcgcgatcgtcggcagctcgatcatcctg
ggcgtcatgctcgacggcagtgagtcggccctcgccctggtgcagtggggcaagatcggc
gagatcgccgtttcctgggtgctctcgccgctgctgggcggcctcgtctcctacctgctg
ttctcgctgatcaagcggcacgtcctggtctacaacgacgagatggatcagcagctcaag
agcctccgccaggagaagaagacttacaagaaacagcacaaggaagccttcgagcgcctc
tccgaactccagcagatcgcctatacccacgccatggcgcgcgatgccgacgtgatgagc
gatcacaacttccaccccgaggatctggagtccgactactaccgcggcctgcacgccatc
aagcagaagcgcggcgaaatcgatgcccaccgggcgctggaaaactgggtgccgctgatc
gccgcgctgggggcgatgatcatttcctccatgctgctgttcaagggcctcaagaacatg
aatctggggctcaccaccctgcacaattacctcatcatgggcatgatcggcgccgccgtg
tggatggccaccctcatcttcgccaagaccctcaagggcgaatcactggacaagtcgacc
ttcctgatctttagctggatgcaggtcttcaccgcctcgggcttcgccttcagccacggc
gccaacgacatcgccaacgccatcggaccgttcgccgccatcctcgacgtgctgcgcacc
ggcgagatgggcagccaggccgcggttccccccctggcgatgatcaccttcggggtggcg
ctcatcgtcggcctgtggttcatcggcaaggaggtcatccagaccgtcggcaccaacctc
accgagatgcacccggcctcgggcttcaccgcggaactggcggcggcagcggtggtgatg
ctggcctcgctgctcggcctgcccgtctccagcacccatatcctgatcggcgccgtgctc
gggatcggcctggtcaaccggcagaacaactgggacctcatgaagcccatcgccctggcc
tgggtgatcaccctaccggcggcggccatcctgagcgccatcgccttcgtggtgctgagg
agcgtcttctga

DBGET integrated database retrieval system