KEGG   Anabaena cylindrica: Anacy_1272Help
Entry
Anacy_1272        CDS       T02435                                 

Definition
(GenBank) FMN reductase
  KO
K00299  FMN reductase [EC:1.5.1.38]
Organism
acy  Anabaena cylindrica
Pathway
acy00740  Riboflavin metabolism
acy00920  Sulfur metabolism
acy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Anacy_1272
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Anacy_1272
Enzymes [BR:acy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     Anacy_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 SecD-TM1 TFIID_20kDa
Motif
Other DBs
NCBI-ProteinID: AFZ56803
UniProt: K9ZC58
Position
1514300..1514887
Genome map
AA seq 195 aa AA seqDB search
MTYILASPPVAVGIAGSPSHPSRTYGLLEYATQFISQQGLETDIISVRDLPAEDLVYGRY
NSPALEKPKALLEKASGVIIATPIYKAAYTGLLKSFLDLLPQKALTGKVLLPLATGGTIA
HLLSIEYALKPVLGELGARHILSTVYAVDKQIQIQADGNLQLDQELEERLQEVLKEFVQT
VNNAQLDVKQLTYSN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgacttatattttagcgtcaccaccggtcgccgtaggcatcgctggtagtccttctcat
ccttccagaacctacggacttttagaatatgcaactcaatttatttcccagcaagggtta
gaaacagatatcatttctgtgcgggatttacctgctgaggatttagtttatggacgttac
aatagtccagctttagaaaaaccaaaagcactcctagaaaaagcaagtggggtaattatc
gctacgccaatttacaaagctgcatacactggcttactcaaatcttttttagatttatta
ccccagaaagctttgactggtaaagttttacttcccttagctactggaggtactattgct
catttattatcaatagaatatgccttaaaacctgttttaggtgaattaggggcaaggcat
attttaagtacagtttatgcagtggataagcaaattcaaattcaagctgatggcaatctt
caattagatcaagaactggaagaacgcctacaagaagttttaaaagaatttgtacaaact
gtaaataatgcccagttagatgtcaaacaactaacttatagtaattaa

DBGET integrated database retrieval system