KEGG   Anabaena cylindrica: Anacy_1473Help
Entry
Anacy_1473        CDS       T02435                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
acy  Anabaena cylindrica
Pathway
acy00010  Glycolysis / Gluconeogenesis
acy00052  Galactose metabolism
acy00500  Starch and sucrose metabolism
acy00520  Amino sugar and nucleotide sugar metabolism
acy00521  Streptomycin biosynthesis
acy01100  Metabolic pathways
acy01110  Biosynthesis of secondary metabolites
acy01120  Microbial metabolism in diverse environments
acy01130  Biosynthesis of antibiotics
acy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anacy_1473
   00052 Galactose metabolism
    Anacy_1473
   00500 Starch and sucrose metabolism
    Anacy_1473
   00520 Amino sugar and nucleotide sugar metabolism
    Anacy_1473
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Anacy_1473
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Anacy_1473
Enzymes [BR:acy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Anacy_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFZ56982
UniProt: K9ZEE8
Position
complement(1725161..1726186)
Genome map
AA seq 341 aa AA seqDB search
MTLLLAGDIGGTKTILRLVESSNSPALNTLYEQSYRSGDFPDLVPMVQQFLAAAKSSTPE
KACFAIAGPVVKNTAKLTNLAWFLDTERLAQELGILSIILINDFAAVGYGIFGLTKQDLL
TLQAGKHQPEAPMAVIGAGTGLGQGFLIKQGNQYQVFPSEGGHADFAPRNELEFQLLKYL
LDKHDIQRVSAERVVSGLGITSIYQFLRDRKIATESPEIAEVVRNWEQEAGQQEKTADPG
AAIGSAALAKSDRISEQTMQLFVEAYGAEAGNLALKLLPHGGLYIAGGIAPKIMPLMQDG
SFMLNFTQKGRMRSILEEIPVHIIVNQQVGLIGAALCASRL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacattgctactagcaggagacatcggcgggacgaaaacaattttgcgattggtggaa
tcctcaaactcaccagcgttaaataccctgtatgaacagagttaccgcagtggagatttt
cccgatttagtgccgatggtacagcaatttttggcagcagctaaatcctcaacaccagaa
aaagcctgttttgcgatcgctggcccagtggtaaaaaatactgctaaactaactaattta
gcctggtttttagatacagaacgtttagcccaagagttaggaatactttccatcattctc
attaatgactttgccgcagtaggttatggcatttttggtttaactaaacaagatttgctg
actttgcaagctggtaaacatcaaccagaagcacctatggcggttattggtgcgggaact
gggttaggacaaggatttttaattaaacagggaaatcagtatcaggtttttccctccgaa
ggtggacacgcagattttgcaccccggaatgaattagaatttcaacttttaaaatatctg
ttggataaacatgatattcaacgggtttctgccgaaagagtagtttccgggttggggatt
acttcgatttatcagtttttgcgagatagaaagatagccacagaatccccagaaattgct
gaagttgtgagaaattgggaacaagaagcgggacaacaagaaaaaactgctgatcctggt
gcggctattggtagtgcagccttagctaaaagcgatcgcatttccgaacaaaccatgcaa
ctttttgttgaagcctacggtgcagaagccggaaatctggctttaaaactcttaccccac
ggtggattatacattgctggtggcattgcccctaaaatcatgcctttaatgcaagatggt
agttttatgttaaattttacccaaaaagggagaatgcgctccatcctcgaagaaatccct
gttcacataattgttaatcaacaagtaggattaattggtgctgctttgtgtgcttctagg
ttataa

DBGET integrated database retrieval system