KEGG   Anabaena cylindrica: Anacy_3766Help
Entry
Anacy_3766        CDS       T02435                                 

Definition
(GenBank) UDP-glucuronate decarboxylase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
acy  Anabaena cylindrica
Pathway
acy00520  Amino sugar and nucleotide sugar metabolism
acy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Anacy_3766
Enzymes [BR:acy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Anacy_3766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind DUF1815
Motif
Other DBs
NCBI-ProteinID: AFZ59147
UniProt: K9ZKR5
Position
4302240..4303175
Genome map
AA seq 311 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLMADSHEVICLDNFYTGHKRNILKWLNNPHFEMIRHDITEG
IRLEVDQIYHLACPASPVHYQYNPIKTVKTNVMGTLNMLGLAKRVKARFLLASTSEVYGD
PEVHPQTEDYRGSVNPIGIRSCYDEGKRMAETLAFDYYRENKVDIRVARIFNTYGPRMLE
NDGRVVSNFIVQALRGNPLTVYGEGTQTRSFCYVSDLVEGLIKLMNGDYIGPVNLGNPDE
YTILELAQAVQNLVNPDAQIKFEPLPSDDPRRRRPDITRAKTWLNWEPTIPLQDGLKLAV
EDFRERIESNN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttggtaacaggcggtgctggatttattggttcccatctgatcgacagacta
atggctgatagtcatgaggttatatgtttagataatttctatacaggacataaacgcaac
attctcaaatggttaaacaatcctcattttgaaatgattcgtcacgacatcactgaggga
attcggttagaagtggatcaaatctatcatttggcttgtccagcatcgccagtgcattac
cagtacaaccccattaaaaccgttaaaactaacgtgatgggaacactgaatatgttggga
ttagccaaacgtgtcaaagctagatttttgttagcttccaccagtgaagtctacggagat
ccagaagttcatccccaaaccgaggattatcgaggcagcgtcaaccccattggcatccgt
tcctgctacgacgaaggcaaaagaatggctgaaactttggcatttgactactaccgagaa
aataaagttgatattcgagtagccagaatatttaacacctatggcccacgaatgttagaa
aacgatggtcgggtagtgagcaactttatagttcaagccttgcggggtaatcccttgacc
gtatatggagaaggtacacaaactcgcagcttctgctatgtctcagacttagttgaagga
ctaattaagttgatgaatggggactacattgggccagtcaatttgggtaatcccgatgaa
tacacaattttagaattggcacaagctgtgcagaacttggttaacccagatgcacaaatt
aagtttgaacccctaccttcagatgatccccgtcgtcgtcgtcccgatattaccagagcc
aaaacctggttaaattgggaacctactattcctctgcaagatggcttaaaactggctgta
gaagattttcgcgaacgtatcgaaagcaacaattag

DBGET integrated database retrieval system