KEGG   Anabaena cylindrica: Anacy_5398Help
Entry
Anacy_5398        CDS       T02435                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
acy  Anabaena cylindrica
Brite
KEGG Orthology (KO) [BR:acy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Anacy_5398
Enzymes [BR:acy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Anacy_5398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AFZ60717
UniProt: K9ZQB7
Position
complement(6119795..6120610)
Genome map
AA seq 271 aa AA seqDB search
MKSYLAAAIQMTSVPDLQKNLTQAEELIDLAVRQGAELVGLPENFSFMGEEKDKLAQADA
LAQVTETFLIKMAQRFQVTILGGGFPVPVGDGTGKVYNTALLINPNGQELARYHKAHLFD
VNVPDGNTYQESSTVMAGKALPPVHFSDNLGNLGLSICYDVRFPELYRHLADKGADVVFV
PAAFTAFTGKDHWQVLLQARAIENTCYVIAPAQTGTNYARRQTHGHAMIIDPWGVILADA
GDKPGVAIAEIKPTRLEQVRRQMPSLQHRVF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttatttagccgccgctattcaaatgaccagtgtgcctgatctacagaaaaac
ttgacacaggcagaggaattaattgatttggctgtgcgtcagggtgcagaattggtaggg
ttgccagaaaatttctcttttatgggagaagaaaaagacaaacttgctcaagcagatgct
cttgctcaagtaacggaaacatttttaattaaaatggcgcagcgctttcaagtaactata
ctcggcggcggctttcctgtacccgtaggagacggcacaggcaaagtctataacacagcc
ttactcattaaccccaatggccaagaactggcccgttaccacaaggcacatttatttgat
gtcaatgttcctgatggtaacacttatcaagaatctagtactgttatggctggtaaagct
ttacccccagtccatttttccgacaacctgggtaatctaggactttctatttgctatgat
gtccgcttccccgaactgtatcgacatctagcagacaagggagcggatgttgtttttgtt
cctgcggctttcacggcttttacgggtaaagaccattggcaagtattgttgcaagccaga
gcgattgaaaacacttgttacgtcattgctcctgcccaaactggcactaactacgcccgt
cgtcaaactcacggtcatgcgatgattatcgacccttggggggtaattctagcagatgcc
ggagataaaccaggagttgcgatcgcagaaattaaacccaccagactagaacaagtacgc
cgccaaatgccatctttacagcatcgcgtgttttag

DBGET integrated database retrieval system