KEGG   Anser cygnoides domesticus (swan goose): 106030215Help
Entry
106030215         CDS       T04896                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00010  Glycolysis / Gluconeogenesis
acyg00562  Inositol phosphate metabolism
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106030215 (MINPP1)
   00562 Inositol phosphate metabolism
    106030215 (MINPP1)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106030215 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106030215 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 106030215
NCBI-ProteinID: XP_013027319
Position
Unknown
AA seq 263 aa AA seqDB search
MRFFDHCDKFIAFVEENDTAMHQVNAFKEGPEMRKVLEKVASALCLPVEELNADLVQVAF
LTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINSRSSCILFQDIFQ
QLDKAVEESNSSKPISSPLIVQVGHAETLQPLLALMGFFKDDEPLRANNYIRQAHRKFRT
GRIVPYAANLVFVLYHCDQVKTSKEEYQVQMLLNEKLMPFHHSNETISTYADFKDYYKDI
LQNCHFKEVCELPKVNITAIDEL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaggttttttgatcactgcgacaagttcatagccttcgtggaggagaacgacacagca
atgcaccaagtgaatgccttcaaagaggggcctgagatgaggaaggttttggaaaaggta
gcaagtgccttgtgtttgccagtggaggagttaaacgcagatcttgttcaagtggctttt
ctcacctgctcatatgagctggctataaaaaatgtgacctccccatggtgttcgctcttc
agtgaagaggatgccaaggtactggaatacttgaatgacctgaagcaatactggaagaga
ggatatggctatgacatcaatagtcgctccagctgcattttgttccaagatatcttccag
cagttggacaaagcagtggaagagagcaatagttcaaaacccatttcttcacctttgatt
gtacaagttgggcatgcagagacacttcagccactgcttgctcttatgggtttcttcaaa
gatgacgagcctctcagggcaaacaactacatcaggcaagcgcatcggaaatttcgcact
ggccggattgtgccttatgcagccaacctggtatttgtgctttaccactgtgatcaagtg
aaaacctctaaagaggagtatcaagtgcagatgttgttgaatgaaaagctgatgccgttt
catcactcaaatgaaaccatctctacttacgcagacttcaaggactattacaaggacatc
cttcaaaactgtcacttcaaagaagtgtgtgagttgccaaaggttaatattactgccatt
gacgaactttga

DBGET integrated database retrieval system