KEGG   Anser cygnoides domesticus (swan goose): 106031631Help
Entry
106031631         CDS       T04896                                 

Gene name
PARP1
Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg03410  Base excision repair
acyg04210  Apoptosis
acyg04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    106031631 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106031631 (PARP1)
   04217 Necroptosis
    106031631 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acyg03032]
    106031631 (PARP1)
   03036 Chromosome and associated proteins [BR:acyg03036]
    106031631 (PARP1)
   03400 DNA repair and recombination proteins [BR:acyg03400]
    106031631 (PARP1)
Enzymes [BR:acyg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     106031631 (PARP1)
DNA replication proteins [BR:acyg03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     106031631 (PARP1)
Chromosome and associated proteins [BR:acyg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    106031631 (PARP1)
DNA repair and recombination proteins [BR:acyg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     106031631 (PARP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Motif
Other DBs
NCBI-GeneID: 106031631
NCBI-ProteinID: XP_013029554
Position
Unknown
AA seq 995 aa AA seqDB search
MPWIRTGPRFSRLFIPVTEQMSPMFDGKVPHWHHYSCFWKRARIVSHTDIDGFPELRWED
QEKIKKAIETGGPGGGKGGDQEGGGKAEKSLNDFAAEYAKSNRSTCKGCEQKIEKGQIRI
SKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGATQLLGFGILKAEDKETLKKQL
PATKSEGKRKGEEVDGNVTVKKKQKKEKEKESKQEKQLKEQTELIWGIKDELRKVCSTND
LKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDAYYCSGDITAWTK
CVAKTQTPNRKDWVIPKEFREIPYLKKFKCKKQDRIFPPEAATVNSAPPPHASAPLTETV
SAPQDKPLANMKILALGKLSKNKEEVKNIVEELGGKMTTTANKATLCISTQKDLEKMSKK
MEEVKDAKVRVVSEEFLQDVKSSSKSFQELLSIHAISPWGAEIKMEHHEVAVDGKCSKPQ
HTKSAGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLEDSAHVFEKGGKIFSATLGLVDI
VKGTNSYYKLQLLEDDRESRYWVFRSWGRVGTVIGSNKLEQMPSKEDAVEHFLNLYEEKT
GNSWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVGAGTKSKLAKPIQDLIKMIFDVESM
KKAMVEFEIDLQKMPLGKLSKRQIQSAYSIPGERERDFGAVSDNGSESQILDLSNRFYTL
IPHDFGMKKPPLLNNLEYIQAKVQMLDNLLDIEVAYSLLRGGNEDGDKDPIDINYEKLRT
DIKVVDKDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFRIEREGESQRYKPFKQLHNRQL
LWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLI
LLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTNLDGVEVPLGNGISTGI
NDTCLLYNEYIVYDVAQVNLKYLLKLKFNYKTSLW
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggataagaactggaccaagattctctaggctttttataccagttactgaacag
atgtcacccatgtttgatggcaaagtccctcactggcaccactacagctgcttctggaag
cgggctcggattgtgtcccacacagacattgatggctttcctgagcttcggtgggaagat
caggagaaaatcaagaaagccattgaaactggaggccctggaggaggaaaaggaggggac
caggaaggaggtggcaaggctgagaagagtctaaatgactttgctgcagaatatgcgaag
tctaacaggagtacttgcaaaggctgtgaacagaaaatagaaaagggacagattcggatt
tccaagaagatggtacatcctgaaaaaccacagctgggaatgatcgataactggtaccac
ccagactgctttgtgagccgccgagcggagctgggtttcctcccagcatacggggccacc
cagctccttggcttcggcatcctgaaagctgaagataaagaaactctgaagaagcagctc
ccagctaccaagagcgaagggaagagaaaaggagaagaagtagatggaaatgtgactgtg
aaaaagaagcagaaaaaagagaaagagaaggaatcaaagcaggaaaaacagctgaaggaa
cagacagagctgatctggggcatcaaggatgagctgaggaaggtctgctccactaatgat
ctgaaagagctgctgattgccaacaagcaggaagtgccttcaggggagaatgccatcttg
gaccgagtggcagatgggatggcatttggagctctgcttccctgcgaggagtgtaaaggg
cagtttgtattcaagagcgatgcgtattactgttcaggggacatcactgcctggactaag
tgcgttgctaaaacacagactcccaacaggaaagactgggtaatcccgaaggagtttcgt
gaaattccttatctcaagaaatttaagtgtaagaaacaggataggatattccctccagag
gctgcaactgtgaactctgcacctcctccacatgcgtctgctcctttgacagagaccgtt
tctgcaccccaagacaaaccactggccaacatgaagatcctggctcttggaaagctgtcc
aagaacaaggaggaagtgaagaacattgtggaggagttgggaggaaagatgacgacgaca
gctaacaaggccaccctgtgcatcagcacacagaaggatttggagaaaatgagcaagaag
atggaagaagtgaaggacgccaaagtccgcgtggtctcagaggagtttcttcaggatgtg
aaatcctccagcaagagctttcaggagcttctttctatccatgcaatttcaccttggggt
gcagagataaaaatggagcaccacgaggtggccgtggatgggaaatgcagcaagccccag
catacaaagagtgctgggaaggtcaaagaagaacaaggacctagcaagtctgaaaagaaa
atgaagctaacagttaaaggtggagcagcagtagatcctgattctggtttggaggattct
gcgcatgtgtttgaaaaaggtggaaagattttcagtgcaactcttggtctagtggatatt
gtgaaaggaacaaattcctattacaaactgcagctcctagaggatgacagagagagcagg
tactgggtgtttagatcctggggtcgtgtgggcactgtaattgggagtaacaagctggag
cagatgccatcaaaagaagatgctgttgaacacttccttaacttgtatgaagagaaaacc
ggcaattcttggcattcaaagaacttcactaaatatcccaaaaaattctacccactggaa
atagattatggacaggatgaagaagctgtcaagaaactcacagtgggtgccgggactaaa
tcaaaacttgctaagccaatccaagacctcattaagatgatctttgatgtggaaagcatg
aagaaagcaatggtggaatttgagattgacctgcagaagatgccactgggaaaactgagc
aagcgacagatccagagcgcatactccatcccaggtgagcgtgaaagagattttggagcg
gtttctgacaatggttctgaatcccagatcttggatctctccaaccgcttctatactctg
attcctcacgactttgggatgaagaaaccacctctcctaaataacttagaatacattcag
gctaaagtgcagatgttggacaacttgcttgatattgaggttgcttacagccttctcaga
ggtggaaatgaagatggagataaagacccaattgacatcaactacgaaaagctccgaact
gatattaaggtcgttgacaaagattcagaggaagccaagattattaaacaatatgtgaaa
aatactcatgctgctactcacaatgcatatgacctcaaagtcgtggatatcttcaggatt
gagcgtgaaggagagagtcagcgctacaagccctttaagcagcttcataatcgccagctg
ctgtggcatggttcccgcactaccaactttgctggtatcctctcacagggtctccggata
gctccccctgaagctcctgtgactggctacatgtttgggaaaggcatctattttgcagac
atggtatccaagagtgctaactactgtcacacatctcaagctgatcccatagggttaata
ctcctgggagaagttgcgcttggaaacatgtatgagctaaagaatgcttctcacataaca
aaattgcccaagggaaaacacagtgtgaaaggcttaggcaaaactgcacctgatcccaca
gctactaccaaccttgatggtgtagaggttcccttagggaatggaatctcaacaggaatt
aatgatacctgtcttctgtataacgaatacattgtgtatgatgttgctcaggtaaatctg
aagtacctgctgaaactgaaattcaactataagacatcactctggtga

DBGET integrated database retrieval system