KEGG   Anser cygnoides domesticus (swan goose): 106032673
Entry
106032673         CDS       T04896                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00230  Purine metabolism
acyg00240  Pyrimidine metabolism
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106032673
   00240 Pyrimidine metabolism
    106032673
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106032673
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 106032673
NCBI-ProteinID: XP_013031178
Position
Unknown
AA seq 322 aa
RTTPISKKPCSRGWAEAGAGGSRQRLRGRQQEAALPSRPPLGGRLKAGRSSQLPSAPSHT
PAKRRCCGPSSSLDSSFQKRLKKISIEGNIAAGKSTFVRLLEKHSDEWEIIPEPIAKWCN
IQTAEDEYEELSTSQKNGGNLLQMLYDKPTRWAYTFQTYACLSRVRAQLKPISAKLYEAE
HPVQFFERSVYSDRYVFASNLFESGNINETEWTIYQDWHTWLLNQYEPDIELDGIIYLRT
TPQKCMERLQTRGREEEQGIELEYLENLHYKHETWLYERTLRVDFENLKEIPILVLDVNE
DFKNDKIKQEYLIDEVKSFLTS
NT seq 969 nt   +upstreamnt  +downstreamnt
cgcacaacacccatttcaaaaaagccctgcagcagaggctgggcggaggcaggagcgggg
gggagcaggcagaggctgcgcgggaggcagcaggaggcagccctcccctcccgcccaccg
cttggcgggagacttaaagcaggcaggagcagccagctgccctcagcccccagccatacc
cctgccaagcggcgctgctgcggccccagcagctccctcgactccagcttccagaagcgc
ctcaagaagatttccatcgaggggaacatcgctgcagggaagtctacgtttgtcaggcta
ctcgagaaacacagcgatgagtgggagataatccctgaacctattgccaagtggtgcaac
attcagacagctgaagatgagtatgaggagctttcaacatctcagaagaatggaggaaat
ctacttcaaatgctgtatgataagcccacaagatgggcttacacttttcagacttatgct
tgcttgagccgagtaagggcacaattaaaacccatctcagccaaattatacgaagcagaa
catccagtgcaattttttgagagatctgtgtacagtgacagatatgtgttcgcttctaac
ctgtttgaatctggaaacatcaatgaaacagagtggactatctatcaggactggcacact
tggcttttgaatcagtatgaacctgatatagaactggatggcatcatctacctcagaacc
acacctcagaaatgcatggaaaggctgcagacaaggggaagagaagaggaacaaggaatt
gagcttgagtatttggaaaacctccactataaacatgaaacatggctttatgaaagaact
ctgagagttgactttgagaaccttaaagaaatccccattcttgttttggatgttaatgaa
gattttaagaatgataagattaaacaggagtacctaattgatgaggtcaaatctttcctg
acttcgtaa

DBGET integrated database retrieval system