KEGG   Anser cygnoides domesticus (swan goose): 106033919Help
Entry
106033919         CDS       T04896                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106033919 (THNSL2)
Enzymes [BR:acyg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     106033919 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 106033919
NCBI-ProteinID: XP_013033173
Position
Unknown
AA seq 487 aa AA seqDB search
MEYVSTRGGSRAVDFEGALFSGYAPDGGLFMPRSIPSLDGATLQRWSRLSYPELVKELCS
LFIAPELVPRSALNDLIDRAFSRFRHKDVVHMSRLKDGLNVLELWHGVTYAFKDLSLSCT
GQFLQYFLEKKQKHITILVGTSGDTGSSAIESVRGQQNMDIFVLLPEGLCTQIQELQMTT
VIEDNVHVFAAHGNSDQIDELIKELFADVDFSRKYNLMSLNSVNWSRIMVQIAHHFYAYF
RCAPSLDTTPLPVVEIVVPTGGGGNITAGCIAQKMGLPIQLVAVVNSNDIIHRAVQHGDF
SASEHVKATLASAMDIQEPCNVERILWLLSGCDSHLTKVLMEQFTASKSLKLPEALHRKL
SETLRSSSASDEDIVRAMQRCWEENRCLLCPHTAVAAHYHYSQLDSCASSTPRCCLASAS
AAKFQDAVPRAGLVPQLPPEITALTAMETRSTALRRGEDWARVLRDRIAAAVQGWEARQG
GSAPPGL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagtatgtcagcacacggggaggctcgagggctgtcgacttcgagggagccctcttc
tccggctacgctcctgacggcggcctcttcatgccccggagcatcccctcactggacggg
gccaccctgcagcgctggagccgcctctcctaccccgagctggtgaaagagctgtgctcc
ctcttcatcgcgcccgagctggtcccgcggagcgcgctcaacgatctgattgacagggcc
ttcagcagattcagacacaaggatgttgtccatatgtccaggctgaaagatgggctgaat
gttctggagctctggcatggggttacttatgcttttaaggatctgtccttgtcctgcact
gggcagtttttacagtacttcttggagaaaaagcagaaacacatcactattctggtgggg
acttcgggggacacagggagctcagccatcgagagcgtgagaggtcagcagaacatggac
atctttgttctgctgcccgaagggctctgcacgcagatacaggaacttcagatgaccact
gtcattgaagacaatgtccacgtctttgctgctcatgggaactccgatcaaatcgatgag
ctgatcaaggaactgttcgctgatgtcgatttttccagaaaatacaatctgatgagcttg
aattcagtcaattggtcaaggattatggtgcagattgctcaccacttctatgcttacttt
cggtgtgccccgtccctggataccaccccgctgccagtggtggaaattgttgtgccaaca
ggagggggaggaaatatcacagctggctgtattgcccagaagatgggtcttccgattcaa
ctggttgctgtggttaacagcaacgacatcattcacagggccgttcagcacggagatttc
tcagcatcagagcacgtgaaggctacgttagcatcagccatggatattcaggagccttgc
aacgtggagaggatcctctggctgctctcaggctgtgacagccacctgacaaaagtgctg
atggaacagttcactgcgtcgaaaagcctgaagctgccggaggctctgcacaggaagctc
tccgagactctgcgctcaagctcggcgtctgacgaggacatcgtgcgagccatgcagcgc
tgctgggaggaaaaccggtgcctgctgtgcccccacacagccgtggctgctcactaccac
tactcgcagctggacagctgtgccagcagcacgccccgatgttgcttagcttcagcctcc
gctgccaaatttcaggacgccgtgccgcgagcgggcctggttccccagctccctcccgaa
atcaccgccctgacggcgatggagacccggtccacagccctgcggcggggggaggactgg
gcacgagtgctccgggaccgcatcgcagccgcggtgcaggggtgggaggcacggcagggt
gggtcagcccccccaggactgtag

DBGET integrated database retrieval system