KEGG   Anser cygnoides domesticus (swan goose): 106034155Help
Entry
106034155         CDS       T04896                                 

Gene name
MTMR2
Definition
(RefSeq) myotubularin-related protein 2 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00562  Inositol phosphate metabolism
acyg01100  Metabolic pathways
acyg04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106034155 (MTMR2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    106034155 (MTMR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acyg01009]
    106034155 (MTMR2)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     106034155 (MTMR2)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     106034155 (MTMR2)
Protein phosphatases and associated proteins [BR:acyg01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    106034155 (MTMR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase 3-PAP DSPc Y_phosphatase3 NYD-SP28_assoc
Motif
Other DBs
NCBI-GeneID: 106034155
NCBI-ProteinID: XP_013033540
Position
Unknown
AA seq 571 aa AA seqDB search
MEEPPLLPGETIKDMAKDVTYICPFTGAIRGTLTVTNYRLYFKSMERDPPFVLDASLGVI
NRVEKIGGASSRGENSYGLEIVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPL
FAFEYKEVFPENGWKVYDPIWEYRRQGIPNESWRLTKINERYELCDTYPAILAVPVNIPD
EELKRVASFRSRGRIPVLSWIHPESQATITRSSQPMVGVSGKRSKEDEKYLQAIMDSNAQ
SHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYP
NIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLSL
LMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTR
QFPTAFEFNEYFLITILDHLYSCLFGTFLCSSEQQRVKEGLPKKTVSLWSYINSQLEDFT
NPLYVSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPVHNRYKELLAKRAELQKKVE
ELQREITNRSTSSSERAGSPAQCGTPVQTVV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggaagagccacccttgctaccaggagaaaccattaaagacatggctaaggatgttaca
tacatctgccccttcactggagcaatcagaggaaccctcactgttaccaattacagactg
tattttaaaagcatggaacgggaccctccttttgtcctagatgcatctttaggtgtaatc
aacagagtggagaaaataggaggggcttccagtcgtggcgagaattcatatgggctggag
attgtatgcaaggacattagaaacttacgatttgctcataagcctgaagggagaactaga
cgatccatatttgagaacttgatgaagtatgcttttccagtttcaaataatctgccactt
ttcgcgtttgagtacaaagaggttttcccagaaaatggatggaaggtgtatgaccccatt
tgggagtacagaagacagggaattcccaacgaaagctggaggttgaccaagattaacgag
cgctatgagctgtgcgatacgtaccctgccattctagctgtgcccgtaaacattcccgat
gaagaattaaaacgagtagcatctttcagatcaagaggacgcataccagtattgtcatgg
attcacccagaaagtcaagcaaccatcactcgcagtagccagccaatggtgggagtgagt
ggcaaacgaagcaaggaagatgaaaagtaccttcaagccatcatggattctaatgctcag
tcccataaaatcttcatatttgatgcaaggcctagtgtgaatgctgtagccaataaagct
aaaggaggaggctatgagagcgaggatgcctatcagaatgcagaattagtgttcctggac
attcacaatattcatgtcatgagagagtcgctgagaaaactgaaagaaatcgtgtatccc
aatatcgaggagactcactggctgtctaatttagaatcaactcactggcttgagcatatc
aagctcattctcgctggagcccttcggatcgccgacaaggtggagtcagggaagacatct
gtggttgtacactgcagcgatggctgggaccggacagcccagctcacttccctctctctg
ctcatgttagatggctactaccgaaccatcaggggctttgaagtactagtggagaaggag
tggctgagcttcggccacaggtttcagctgagagttggccatggagataagaatcatgca
gacgcagatcgctctcctgtcttcctccagttcatcgattgtgtctggcaaatgacaaga
cagtttcctacagcgtttgagttcaacgagtacttcctgataaccatcctggatcacctg
tacagctgtttgtttgggacgttcctgtgcagcagtgagcagcagagagtgaaggagggc
cttccgaaaaagactgtgtcgctttggtcatacatcaacagccagctcgaggacttcact
aaccccttgtacgtgagctactccaaccacgtcctgtaccccgtggcgagcatgcgccac
ctcgagctgtgggtcggctactatatccgctggaaccccaggatgaagccacaggaacct
gtccacaatcgctacaaggagcttcttgccaagcgggctgagctgcagaagaaagtggag
gaactgcagcgagaaatcaccaaccgttccacctcgtcctcggagagagctggctctccc
gcacagtgcggcacccctgtacagactgttgtataa

DBGET integrated database retrieval system