KEGG   Anser cygnoides domesticus (swan goose): 106035986Help
Entry
106035986         CDS       T04896                                 

Gene name
ERP44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acyg04131]
    106035986 (ERP44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acyg04147]
    106035986 (ERP44)
Membrane trafficking [BR:acyg04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    106035986 (ERP44)
Exosome [BR:acyg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106035986 (ERP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 Thioredoxin_2 HyaE Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 106035986
NCBI-ProteinID: XP_013036598
Position
Unknown
AA seq 398 aa AA seqDB search
MTARQTGSFTKVSWLFNPTRSEITSLDSGNIDDILNNADVALVNFYADWCRFSQMLHPIF
EEASNVIKEEYPDKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRS
VTAIADYIRQQKSNPIREVQDLEEINTADRSRRNIIGYFEQKDSDNYRTFERVANILHDD
CVFLSAFGAISKAERFSGDNIIYKPPGENAPDMVYLGSLTNFDLIYAWTQDKCVPLVREI
TFENGEELTEEGLPFLILFHMKDDLESLEKFQQEVARQLISEKGTINFLHADCDKFRHPL
LHIQKTPADCPVIAIDSFRHMYVFPDFSDLSVPGKLKQFVLDLHSGKLHREFHHGPDPTD
VAPGQPIQDLASSPPESSFQKLAPSEHRYTLLREKDEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagacaaacgggtagcttcacaaaggtgtcttggctttttaatccaacgaga
agtgaaataacaagtctagatagtggaaatatagatgacattttaaacaatgcagatgtt
gctttagttaatttttatgctgattggtgccgcttcagccaaatgctgcatcctattttt
gaggaagcttctaatgtaattaaggaagaatatccagataagaatcaagtggtgtttgct
agagtagactgtgatcagcactcggatatagctcagagatacaggataagcaaataccca
acactgaagctcttccggaatggaatgatgatgaagagagaatacaggggccagaggtct
gtgacagcaatagcagactatatcaggcagcagaagagcaatcctattcgggaggtccag
gatttggaagaaattaatactgctgatcgcagtagaagaaatatcattggatactttgag
caaaaggactctgacaattacagaacttttgaaagagtagcgaatattttgcatgatgat
tgtgtattcctgtctgcctttggggctatttcaaaagcagagagatttagcggagacaat
ataatctacaagccaccaggggaaaatgccccagatatggtatatttaggctctctaacc
aattttgatttgatttatgcatggacacaagataaatgtgtaccactagttcgagaaatt
acatttgaaaatggggaggaactgacagaagaaggccttccttttctcatacttttccac
atgaaggatgacttggagagtttagagaaattccagcaggaggttgcacgacagttaata
agtgaaaaaggtacaataaacttcctccatgctgactgtgataaattcaggcaccccctc
ctccatattcagaagactccagcagactgtccggttattgctatcgatagcttcaggcac
atgtatgtttttccagacttcagtgacctctcagttccaggtaaactgaagcaatttgta
ctagacttgcattctggaaaattgcatagagagtttcatcacggccctgatccaactgat
gtagcacctggtcagccaattcaggatttagcaagcagcccaccagagagttcattccag
aagctggcacccagtgaacataggtacaccttattgagggaaaaagatgaactttaa

DBGET integrated database retrieval system