KEGG   Anser cygnoides domesticus (swan goose): 106037167
Entry
106037167         CDS       T04896                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acyg01009]
    106037167 (AKAP5)
Protein phosphatases and associated proteins [BR:acyg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     106037167 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 106037167
NCBI-ProteinID: XP_013038421
Position
Unknown
AA seq 530 aa
MSDALTKKTDNTAQTKRGANMAKAAKEIQMENPKELETQSAGTTCSPSEEQAEKPSMLCF
KKRKKSCKKGLTSKDACEGASAASEEKSQCIGTDQGEAKVSAQPRSSRGAWAAIKSLTRP
RRRQKSSSRKKVPSDSQVQLEVDAEEGCTQGFPRKKASSGVKMPCVRFSRGKKKRSPSEV
VEESEGSVQANEEMGISNKAIEEPEDLVPAEEPSRAEPSSPLPAEKDQEDKGTVEEGADA
GRKSEPLAESRPDMDEHAEHTTQLEITSSEAVDEHAEHTTQSQITSSEAAEEHAEHTTQS
EITSSVAVDEPVQEQLPEGSPQQTAVHVEEREVPAEALVSTEQPNSTPEITEVQEIANIC
KELPEGDESERNTNLPEECKAEEIVMDFSQSAFKDEAASVQSSSSHQEKPEVNMGTCVGI
VITVTEAVDSDNDDSDQDYEPTLVLHHNKQKGNKKSSGSFDFGQKEGPEAGSSALAEEKG
LGDQGHRTSDQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtctgatgcattaaccaagaaaaccgataatacagcacagacaaagagaggtgcaaat
atggcgaaggcagctaaggaaattcaaatggagaacccaaaagaactggagacccagagc
gcagggacaacgtgctccccgtcagaagaacaggcagaaaaaccctccatgctctgcttc
aagaagcggaagaagtcctgtaagaaggggctgacctcaaaggatgcatgtgaaggagct
tctgcagcctcggaggagaaaagccaatgcatcggcacagaccaaggggaggcaaaagtt
tctgctcaaccacgatcttccaggggagcctgggcagctattaaaagtctcacaagacct
cgaagaaggcaaaaatcctcttcacggaagaaggtgccctctgattcccaggtgcagctg
gaggtagatgccgaggagggctgcacacaaggtttcccaaggaaaaaggcaagctcaggt
gtgaagatgccctgcgtacggttctcaagaggcaagaaaaagcgtagcccctctgaggta
gtggaggagtcagagggcagtgtccaggcaaacgaagagatgggcatttcgaataaagcc
attgaggagccagaggacctggtgccggcagaggagccaagcagagctgagccttccagc
ccactccctgcggagaaggaccaggaggacaagggtacggtagaagaaggggctgatgct
ggtaggaagagtgagcccttggcagagtccaggcctgacatggatgaacacgcagagcac
accactcagttggaaatcaccagttcagaggcagttgatgaacacgcagagcacaccact
cagtcccaaatcaccagttcagaggcagctgaagaacacgcagaacacaccactcagtca
gaaatcaccagttcagtggcagttgatgaacccgtccaggaacagctgcctgaggggagt
ccgcagcaaactgcagtgcacgtggaagagagggaagtccctgccgaagcactggtttcc
acagagcagcccaacagcacccctgaaatcactgaggtgcaggaaatagctaatatctgc
aaagagctgcctgaaggggatgaatcagagaggaacacaaatcttcccgaggagtgcaaa
gctgaagagatcgtaatggatttcagtcagtcagcatttaaagatgaggcagcgagcgtg
cagagcagctccagccaccaggagaaacccgaagtcaacatgggcacctgcgtcggcatc
gtcatcaccgtcaccgaagccgtggactctgacaacgacgactctgaccaggactatgag
ccgaccctggttttgcaccacaataagcaaaaagggaataaaaaatcaagtgggagcttt
gattttggtcaaaaagagggccctgaggctggcagcagtgctctggcagaggagaaaggc
ctgggtgaccaggggcacaggacttcggatcagtacgagttgctcctcatagaaacagcg
tcttccctcgtgaaggcggccatccagtcatccatagagcagctggtcaacgagatggct
ctggaacagaacaaacacaacagtttcctgtga

DBGET integrated database retrieval system