KEGG   Anser cygnoides domesticus (swan goose): 106037424Help
Entry
106037424         CDS       T04896                                 

Gene name
PHF6
Definition
(RefSeq) PHD finger protein 6 isoform X1
  KO
K23310  PHD finger protein 6
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acyg03000]
    106037424 (PHF6)
   03009 Ribosome biogenesis [BR:acyg03009]
    106037424 (PHF6)
   03036 Chromosome and associated proteins [BR:acyg03036]
    106037424 (PHF6)
Transcription factors [BR:acyg03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    106037424 (PHF6)
Ribosome biogenesis [BR:acyg03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   106037424 (PHF6)
Chromosome and associated proteins [BR:acyg03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    106037424 (PHF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 106037424
NCBI-ProteinID: XP_013038763
Position
Unknown
AA seq 365 aa AA seqDB search
MTSSVGQKKVSSRQRKCGFCRSNKDNECGQLLMSENQKVAAHHKCMLFSSALVSSHTDNE
SLGGFSIEDIQKEIKRGTKLMCSLCHCPGATIGCDVKTCHKTYHYYCALHDKAQIREKPS
QGIYMILCRKHKKTTHNSEADLEESINEHELEPSPPKGKRRGRKGKPRKTNLKGQSEDTR
STSSHGTDEIESSSYRDRSPHRSSPSDTKPKCGFCHAGEEENEARGKLHIFNAKKAAAHY
KSMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACIKT
YHYHCGVEDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKSGTDHNDIPQQ
QLNGN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacaagctcggttggacagaaaaaagtctcttcaagacaaaggaagtgtggtttttgt
agatctaataaagataatgaatgtggacaattattgatgtcagaaaaccagaaggtggca
gcacatcacaaatgtatgctgttttcatctgcactggtatcttcacacactgataatgag
agtctgggtggattctctattgaggatattcagaaagaaataaaaagaggcactaaattg
atgtgttctttatgccattgtcctggagcaaccatcggttgtgatgtgaaaacatgtcac
aagacatatcactactactgtgctttgcatgataaagctcagataagagagaaaccctca
caaggcatttacatgattttatgtcgaaaacacaagaaaactacgcataactctgaagca
gatttagaagaaagtatcaatgaacatgagttggagccttcacctcccaaaggaaaaagg
aggggtcgtaagggaaagccaagaaaaacaaatttaaaagggcaatcagaagacactaga
tccacgtcctcacatggcacagacgaaatagaaagcagttcctatagagacaggtctccc
cacagaagcagccccagtgatacaaaacctaaatgtggattctgtcatgcaggtgaagaa
gaaaatgaagctagaggaaagcttcatatatttaatgccaaaaaggctgcagcacactat
aagtccatgttgttctcttctggcactgtccagctaacaacaacatcaagggcagagttt
ggtgattttgatatcaaaactgttcttcaagaaatcaagagaggaaaaagaatgaaatgc
acactttgcagccagcctggtgctactattgggtgtgaaattaaagcctgcataaaaaca
taccattaccactgtggagtagaagacaaagctaaatacattgagaatatgtcacgagga
atttataaactctattgtaaaaaccatagtggaaatgatgaaagagatgaagaggatgaa
gaaagagaaagcaaaagccgtgggaaatcaggcactgaccataacgacattcctcagcag
cagctcaatggaaactag

DBGET integrated database retrieval system