KEGG   Anser cygnoides domesticus (swan goose): 106037973Help
Entry
106037973         CDS       T04896                                 

Gene name
MGLL
Definition
(RefSeq) LOW QUALITY PROTEIN: monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00561  Glycerolipid metabolism
acyg01100  Metabolic pathways
Module
acyg_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106037973 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acyg01002]
    106037973 (MGLL)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106037973 (MGLL)
Peptidases [BR:acyg01002]
 Serine Peptidases
  Family S33
   106037973 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Lipase_3 PGAP1 Esterase Thioesterase Abhydrolase_5 DUF1350 LIDHydrolase PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 106037973
NCBI-ProteinID: XP_013039608
Position
Unknown
AA seq 304 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQHLFCRYWKPATTARALVFIAHGAG
EHCGRYDELAQRLTELNLFVFAHDHVGHGQSEGDRVVVSDFHVFIRDSLQHIDLMKKDHP
GLPVFILGHSMGGAISILTASERLGDFSGMVLISPLVVASPEVATPIKVFAAKVLNLVLP
NLSLGSIDPNAVSRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLPIL
VLQGSXGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVTTSVFTEILTWVGQKVSAAGE
TSHT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcctccagaatgccagaggaaagttcgccaaagcggagtcctcaa
aacatcccgtacaaagacctgccccacatcatcaacgctgacgggcagcatctcttctgc
aggtattggaagccagcaacaaccgccagggccctcgtgtttatcgctcatggcgctggg
gaacactgcggccgttacgatgagttggcccagaggctgacagaacttaacttgtttgta
tttgcccatgaccatgttggccacgggcagagcgagggggatcgtgtggttgtctcagat
ttccacgtcttcatcagggacagcttgcagcacattgatctcatgaagaaagatcacccc
gggctgcccgttttcatcctgggacattctatggggggagccatctccattctgacagct
agcgagagactcggtgacttttcaggcatggtgttaatctctcctttagtggtggccagc
ccagaagtcgccacccccatcaaggtttttgcagcaaaagtgctcaacctcgttctccca
aacctgtcactgggatcgatagatccaaatgcagtttcccggaacaagaaggagatggag
tcctacacatctgatcccctggtctaccacggtggcatgaaggtgtccttcgtcatccag
ctgatgaacgccattgccagaattgagcgagctctgcccaagctgactttgcccatcctg
gtgctgcagggctcttaagggtcttatttacttatggacacggtgcagagtcaggacaaa
acgctcaaggtgtatgaggaagcctaccatgccctccacaaagagctgcccgaggtcact
acctctgtcttcacggaaatacttacgtgggttggccagaaggtctcagcagctggagaa
accagccatacttaa

DBGET integrated database retrieval system