KEGG   Anser cygnoides domesticus (swan goose): 106038037Help
Entry
106038037         CDS       T04896                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acyg01002]
    106038037 (ABHD6)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106038037 (ABHD6)
Peptidases [BR:acyg01002]
 Serine Peptidases
  Family S33
   106038037 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 Thioesterase C9orf72-like DLH Lipase
Motif
Other DBs
NCBI-GeneID: 106038037
NCBI-ProteinID: XP_013039744
Position
Unknown
AA seq 337 aa AA seqDB search
MDLDVLNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRALGMQVRYANYDDYQF
CYSYRGRPGYRPSILMLHGFSAHKDMWLSIVKFLPKNLHLVCVDMPGHEGTTRSALDDYS
IMGQAKRIHQFVECIKLNKRPFHLVGTSMGGNVAGVYAAQYPEDICSLTLICPAGLPSAT
DSKFVKQLRELQESERIDRIPLIPSTPEEMADMLKLCSYVRFKVPQQILQGLVDVRIPHN
DFYRKLFLEIVDEKSRHSLQENMGKIKAPTQVIWGKQDQVLDVSGANLLASAIPDCHVSI
LENCGHSVVVERPRKTANLMLEFLALLHSTGNSKKQA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggacctggatgtgctgaacatgttcgtcatagccggcggcaccctggccatccccatc
ctggccttcgtggcctccttcctcctgtggccctcggcgctcatccggatctactactgg
tactggcgtcgagcgctgggcatgcaggtccgatacgccaactacgacgactaccagttt
tgttactcctatagagggagacctgggtaccggccgtctatcctgatgctccacggcttc
tcagcccacaaggacatgtggctgtccatagtcaagttcctccccaagaacctgcacttg
gtgtgcgttgacatgcctgggcacgagggcacgacccgctcggccttggacgattactcc
attatgggacaagcgaagaggatccaccagttcgtggagtgcatcaagctgaacaagagg
cccttccacctggtcggcacctccatgggtgggaacgttgctggagtctatgccgcgcag
tacccagaggacatctgcagcctgactcttatctgccccgcgggtctgccgagtgccacc
gacagcaagttcgtcaagcagctccgggagctgcaggagtccgagcgcatcgacaggatc
cctttaattccctcgacgcccgaggagatggccgacatgctgaagctctgctcctacgtt
cgcttcaaggtgccgcagcagatcctccagggcctggttgacgtccgcatcccacacaac
gatttctatcggaaactgtttttagaaatcgtggatgagaagtccaggcactccctccag
gagaacatgggcaagatcaaagcgccgacgcaggtcatctggggaaagcaggaccaggtc
ctggatgtttctggtgccaacctcctagcgagcgccatcccggactgccacgtgtccatc
ctggagaactgcggccactcggtggtggtggagcggccgcggaagacggcgaacctcatg
ctggagttcctggcgctgctgcacagcacgggcaacagcaagaagcaggcgtga

DBGET integrated database retrieval system