KEGG   Anser cygnoides domesticus (swan goose): 106039908Help
Entry
106039908         CDS       T04896                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04115  p53 signaling pathway
acyg04140  Autophagy - animal
acyg04141  Protein processing in endoplasmic reticulum
acyg04210  Apoptosis
acyg04217  Necroptosis
acyg04261  Adrenergic signaling in cardiomyocytes
acyg04340  Hedgehog signaling pathway
acyg04510  Focal adhesion
acyg04621  NOD-like receptor signaling pathway
acyg04933  AGE-RAGE signaling pathway in diabetic complications
acyg05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106039908 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106039908 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106039908 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    106039908 (BCL2)
   04217 Necroptosis
    106039908 (BCL2)
   04115 p53 signaling pathway
    106039908 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106039908 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106039908 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106039908 (BCL2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106039908 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106039908 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acyg01009]
    106039908 (BCL2)
Protein phosphatases and associated proteins [BR:acyg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106039908 (BCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Nitrate_red_del
Motif
Other DBs
NCBI-GeneID: 106039908
NCBI-ProteinID: XP_013042849
Position
Unknown
AA seq 175 aa AA seqDB search
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAVAAAGTPSRHR
PAGLLSPAVVEDLFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRH
LHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggctcatcccgggagaagaggctacgataaccgggagatagtgctgaagtacatccac
tataaactctcgcagaggggatacgactgggctgccggcgaggacagggcgcccgcgcct
acggctctcgctcctgctgctgctgcggttgctgctgctgggactccctcccgccaccgc
cctgccgggctgctgtccccggccgttgtggaggatctcttccgagacggggtgaactgg
ggccggatcgtggccttcttcgagttcggcggcgtgatgtgcgtcgagagcgtcaaccgg
gagatgtctcccctggtggacagcatcgccgcctggatgaccgagtacctgaaccggcac
ctgcacaactggatccaggacaacggaggctgggatgccttcgtggagttgtatggcaac
agtatgaggcctttgttcgatttctcctggatctctctgaagactatcctgagtttggtt
ctggtgggagcttgcatcactcttggcgcttatctcggacataagtag

DBGET integrated database retrieval system