KEGG   Anser cygnoides domesticus (swan goose): 106042978Help
Entry
106042978         CDS       T04896                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00564  Glycerophospholipid metabolism
acyg00565  Ether lipid metabolism
acyg00590  Arachidonic acid metabolism
acyg00591  Linoleic acid metabolism
acyg00592  alpha-Linolenic acid metabolism
acyg01100  Metabolic pathways
acyg04010  MAPK signaling pathway
acyg04217  Necroptosis
acyg04270  Vascular smooth muscle contraction
acyg04370  VEGF signaling pathway
acyg04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106042978
   00565 Ether lipid metabolism
    106042978
   00590 Arachidonic acid metabolism
    106042978
   00591 Linoleic acid metabolism
    106042978
   00592 alpha-Linolenic acid metabolism
    106042978
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106042978
   04370 VEGF signaling pathway
    106042978
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106042978
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106042978
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106042978
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106042978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 106042978
NCBI-ProteinID: XP_013047680
Position
Unknown
AA seq 822 aa AA seqDB search
MGVFYSTSQTEPSPCNLLTVKIIRMKNARKADLLTQSDCYVSLSLPTASVQHFRTKTIPN
TKNPTWNETFHFTIQSQVKNILELKVCDEDNMTQDDHLLTVFFDVSKIQLGENIQLSFQL
NPQGKEELEVEFTMESSPDPPENIITNGVLVSREVSCLDVQVNGGKMRKDSTERKFALTV
DGSYEGTQTHTLSSCLCPTAPARFHYIKYHQSALAVALPRRRRLSRSISSQNERDMNESV
TVALNLLPIQEKITVAQDKTIDLYVKANEWTQGLCFRPRNLDARLGFDLCTDEQNFLQNR
RRVVAAALKDVLHLEEDLQDHEVPIVAVTTAGCGIRALTAMYGSILGLQKLRVLDCISYI
SGSSGTTWTMTKLYEDADWSRKDLGEVIIEARKQATKCKMGAFCLRSLRNYYRELSQRTQ
AGHKTSFIDLWGLMIESMLNDGKCYHRLSDQRRAVNQGQNPLPIYLALSVKDKVATKDFR
EWVEFTPYEVGFLKYGAFIRAEDFGSEFFMGRLMKKLPESRICFMQGMWSSIFSKNLLDA
WHAADNSEDFWHRWTQDKVTEIEEQPDLPEKPYEMATCMFTPTSGLSTTLRDILTDRPAV
SKYHNFLRGFQMHNEYIQHEQFAKWKDTSLDTSPNDLRGNSEHLELVDAAFFFETSCPPL
MRPERKVDVIIHLNYTGGSQTLPLEQACSYFSEQGIPFPNIGLKDDEKNLKECYMFDGAD
TPGAPLLLYFPLVNDTFQRYVAPGMARSAAEMEQGKIDLSSFCSPYSTREVSLKAEDFNK
LQRLTNYNIMNNENMILQALRMAVARKKQALSQPVSQAQASG
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttttacagcacgagccagacagaaccctctccatgcaacttgctcactgta
aaaatcatacggatgaaaaatgccaggaaagcagacttgttaacccagtctgactgctac
gtgagcctgagcctgccaacagcctcggtgcagcatttccgcaccaaaactattccgaac
accaagaacccaacgtggaacgagaccttccacttcacgattcagagccaggttaagaac
attctggagctgaaagtttgtgatgaggacaacatgacacaagatgaccatctcctcact
gttttctttgatgtctccaaaatccagctcggagaaaacattcagctaagtttccagctg
aatccacagggaaaagaggagctggaggttgaattcacaatggagagcagtccggatcct
cctgaaaacattattactaatggcgtcttagtgtcccgtgaagtttcctgtctggatgtg
caggtgaatggcggcaagatgaggaaggatagcacagagaggaaatttgcactaacagtg
gatggctcatacgaagggacccagacccacacgctgagctcctgcctgtgcccgactgca
ccggccaggttccactacatcaaataccaccagtcagcgctggccgtggcgctgccgcgg
cggaggcggctcagcaggtctatatcaagccaaaatgaaagggatatgaatgagtctgtg
actgtagctctgaacttgcttcctatacaagagaaaataacagtagcacaggacaagacg
atcgacttgtatgtaaaggcaaatgaatggacccagggtctgtgtttcaggccaagaaac
ctagatgctcgcctggggtttgacctgtgcacggatgaacagaatttcctgcaaaaccgg
aggagggtggttgctgctgcactgaaggatgttcttcatctggaggaagacctgcaagac
cacgaggtgccgatagtggctgtgacaacagcagggtgtgggataagagcactcactgcc
atgtatggcagcattttgggtcttcaaaagttgcgcgttctggattgcatttcatacatc
agtggctcatctggcacaacatggaccatgaccaaactgtatgaagatgcagattggtca
cgtaaggatctcggagaagtaattattgaagctcggaagcaagcaaccaagtgcaagatg
ggtgctttttgcttgagaagtctgaggaattattacagagagctgagccaaaggacccaa
gcaggacataagacatcttttattgatctgtgggggctcatgattgaatccatgttaaat
gatgggaaatgctaccacagactttctgatcaacgtcgggcagtgaatcagggtcagaac
ccactgcctatctaccttgccctcagtgtcaaggacaaagttgctaccaaagattttaga
gagtgggtggagttcacgccgtacgaggtgggcttcctgaagtatggtgccttcattcgt
gcagaggattttggcagtgagttcttcatgggtcgcctgatgaagaagctccctgagtcc
cggatctgcttcatgcaaggaatgtggagtagtatcttctccaaaaatctcttggatgcc
tggcatgcagctgacaattcagaggacttctggcacagatggacccaagacaaagtgact
gaaatagaggaacaaccagacttgcctgagaagccctacgagatggctacctgcatgttc
actcctaccagtggcctttccacaactctccgggacatcctgacggaccgccctgctgtc
tccaagtaccacaacttcctgaggggcttccagatgcataacgagtacatccagcacgag
cagtttgcaaaatggaaagacacctcgctagacacctctcctaatgacctgagaggcaat
tcagagcacctggagctggtggatgcagctttcttctttgaaaccagctgtccacccctt
atgagaccagagaggaaagtagacgtcatcatacacttaaattacacgggtggatcgcag
accttgcctctagagcaggcttgcagttacttctcggagcagggaattccatttcccaac
attgggctgaaggatgatgagaagaacctgaaggagtgttacatgttcgatggtgcagac
actccgggagctcctctcctgctttattttccactagtgaatgacaccttccaaagatac
gtagcaccaggcatggctcgtagtgctgcggaaatggaacagggcaagattgatctctcc
agtttctgttctccgtactcaacgagagaggtctcgctgaaagcagaagatttcaacaaa
cttcagaggctgactaattacaacataatgaacaatgagaacatgattcttcaggccttg
cgcatggctgtggcacggaagaaacaagctctgagccagccagtatcacaggcacaggcc
tctggttga

DBGET integrated database retrieval system