KEGG   Anser cygnoides domesticus (swan goose): 106043531Help
Entry
106043531         CDS       T04896                                 

Gene name
TIPARP
Definition
(RefSeq) TCDD-inducible poly [ADP-ribose] polymerase
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106043531 (TIPARP)
Enzymes [BR:acyg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     106043531 (TIPARP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE zf_CCCH_4 Torus
Motif
Other DBs
NCBI-GeneID: 106043531
NCBI-ProteinID: XP_013048483
Position
Unknown
AA seq 671 aa AA seqDB search
MDTEAKAACVVQQAHCPGMKCPPPEDFPPQIRLSEKIPPVKPCFKKKQQVQKRLDTQTLR
ALRPIFTSLLGAGTLDRVFVPRGQGGGGHSGLCEPAVKKTLELSTSCPQPESNVAVLVPS
APDVQTQLPGAHPAPGHPEQEVQAGERGFSSETPPGTAAETSAESFQDHPLHPPPSDGAA
CPLFPDKVLESYTSGLFPEGSCPVQYALNPSNKFSAGIFQDKSEEASLDLVFELLNQLQY
HTHQEDGIEICVDFLQGACVYGSDCPKHHTVLPYHWQVRRTATQSWQSVTNDSQEHLERL
YCNPDNDRIKVKYRGHEFWVDLNVMKLYETAEFDQMRRLSTPSCPSSSSNYYTVWKYFCR
DHFVWREYSEPVVRLIEEASCRGLKEVRFVTWHNQYILNIKDGFQQNACFRREIKRRPLL
RSCVVLMPFLQTLGGNSPVPSLSAEPVSSHVLSPTAVTSPNFYPETWISMDPSQDFIQVP
VSKEDKSYRTIYNLFHKTVPETKYKILKILRVQNQFLWEKYKRKKEYMSKKMTGLDRIMN
ERHLFHGTSQDVVDGICKHNFDPRVCGKHATMFGQGSYFARKASYSHNFSKRSPKGVHYM
FLAKVLTGRYTVGNHTMRRPPPVNPGSITSDLYDSCVDNYFEPQIFVIFNDDQSYPYFII
QYEEVSNTVSI
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgaagccaaggcagcgtgtgttgtgcagcaggctcactgcccgggaatgaag
tgccctcctccggaggactttcctcctcagataagactgtcggagaagattccgccggtg
aagccttgcttcaagaagaagcagcaagtgcagaagaggctggacacacaaactctgcgc
gctttgcggccgatctttaccagtttgctgggagccgggaccctggatagggtctttgtg
ccccgaggccagggtggtggaggtcatagtggtttatgtgaacctgctgtgaaaaagact
ctggaactcagtacttcgtgcccccagccagaaagtaacgtggccgtgctggtgccctca
gccccagatgtgcagacccagctgccgggggctcatcctgctcctgggcaccctgagcag
gaggtgcaggcaggggagcgaggcttctcctcagaaactcctcctggaaccgctgctgag
acaagcgctgaatcattccaggatcaccctttgcacccacctcctagcgatggtgcagct
tgtcctttgttcccagacaaggttctggaaagctacacctctggcttattcccggagggt
agctgtcccgtgcaatacgctttgaacccaagcaataaattcagcgccgggatattccag
gataaaagcgaggaggcttctctcgatttggtattcgagctcctgaaccagttgcagtat
cacacccaccaggaggatgggatagaaatctgtgtggattttctccagggcgcgtgtgtt
tatggcagtgattgtcccaaacaccacacggtgctgccctatcactggcaggtgaggagg
acggcaactcagagctggcagagcgtgaccaacgattcccaggagcacctggaaaggctc
tactgcaaccccgacaacgacaggatcaaagtgaaataccggggacacgagttttgggtg
gatttgaatgttatgaaattatatgaaactgctgagtttgaccaaatgcggaggctgtcc
acgccatcctgccccagctccagctccaactactacacggtctggaaatacttctgcagg
gaccacttcgtctggagagaatactccgagcctgttgtaagattgattgaagaagccagc
tgccggggtctgaaagaggtccggtttgttacctggcataatcagtatatcttaaacatc
aaagatggattccagcaaaacgcctgtttcagacgagaaatcaagagaagacccctcctg
cgctcgtgcgtggtgctgatgccgttcttacagactctaggtggcaattctccagtaccc
tctctatcagctgaaccagtttcctcacacgtcttatctccaactgctgttacctctcca
aacttctatcctgaaacctggattagtatggatccatctcaggacttcatccaagtgcct
gtttcgaaggaagataaaagctatagaaccatttataacctgtttcacaagactgtgcca
gagaccaaatataaaattttgaaaattctgagagtgcaaaatcagtttctttgggagaaa
tataaaaggaaaaaggagtatatgtccaaaaaaatgaccgggcttgacaggataatgaac
gaaaggcatttgttccatggcacctcccaggacgtggtggatgggatctgcaagcacaac
ttcgacccgcgtgtctgcgggaagcacgccaccatgttcggacagggcagttactttgcc
agaaaggcgagctattcccataacttttccaaaaggtcacccaaaggagttcattacatg
ttcttggctaaagtactgacgggaagatacacagtgggcaatcacaccatgaggagacct
ccccccgtgaacccgggcagcatcaccagtgacctctacgactcttgcgtggacaattac
tttgagcctcagatttttgtcatttttaacgatgatcagagctacccttattttattatc
cagtacgaagaagttagcaacactgtctccatttga

DBGET integrated database retrieval system