KEGG   Anser cygnoides domesticus (swan goose): 106043942
Entry
106043942         CDS       T04896                                 

Gene name
DCK
Definition
(RefSeq) LOW QUALITY PROTEIN: deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00230  Purine metabolism
acyg00240  Pyrimidine metabolism
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106043942 (DCK)
   00240 Pyrimidine metabolism
    106043942 (DCK)
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106043942 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 Thymidylate_kin AAA_33 AAA_18 BCAS3 AAA_17
Other DBs
NCBI-GeneID: 106043942
NCBI-ProteinID: XP_013049157
Position
Unknown
AA seq 240 aa
MQDENPYSAGKSTFVNILKQADEEWEVVHEPVARWCNVQQNSEDDCEELNTSQKSXNVLR
MMYDKPERWSFTFQTYACLSRIRAQIKSLEGKLREAENPVVFFERSVYSDRYIFAANLYE
SDCMNETEWTIYQDWHDWMNKQFGQSLALDGIIYLRATPEKCLNRIYLRGRDEEQEIPIE
YLEKLHYKHESWLQHRTLRTDFEYLQEIPILTLDVNEDFKGKKDRYDHMTEKVKEFLSTL
NT seq 723 nt   +upstreamnt  +downstreamnt
atgcaagacgagaacccttactctgcagggaaatcaacgtttgtgaatatcctcaaacaa
gctgatgaagaatgggaagttgttcatgagcctgtagctaggtggtgcaatgttcagcaa
aattcggaagatgattgtgaggagctgaatacatcacagaagagcnggaatgtgcttcgg
atgatgtatgataaaccagagaggtggtctttcactttccagacgtacgcctgcctcagc
aggattcgggctcagatcaaatcccttgaaggcaaactcagagaggcagagaatcctgtg
gtcttcttcgaacgatctgtctacagcgacagatacatctttgcagctaatttatatgag
tctgattgcatgaatgaaacagaatggactatttaccaagactggcatgactggatgaat
aagcagttcggtcaaagcctagcgctggatgggatcatttatctcagagctactcctgag
aaatgcttaaataggatttacttgcgtggacgagatgaagaacaagaaattcccattgaa
tatctggagaagcttcactacaaacatgaaagctggcttcagcataggacactgcgaacg
gattttgaatatctacaggaaatacctatcttaacattagatgttaatgaggacttcaaa
ggcaaaaaggacagatatgatcacatgactgaaaaggtgaaggaatttttgagcacatta
taa

DBGET integrated database retrieval system