KEGG   Anser cygnoides domesticus (swan goose): 106044385Help
Entry
106044385         CDS       T04896                                 

Gene name
ERLIN2
Definition
(RefSeq) erlin-2
  KO
K23341  erlin
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acyg04121]
    106044385 (ERLIN2)
Ubiquitin system [BR:acyg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    106044385 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 106044385
NCBI-ProteinID: XP_013049839
Position
Unknown
AA seq 293 aa AA seqDB search
MSKRGAFLKYFSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTA
DYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTTMAPGLIIQAVR
VTKPNIPETIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKIAQVAEITY
GQKVMEKETEKRISEIEDAAFLAREKARADAECYTAMKVAEANKMKLTPEYLQLMKYKAI
AANSKIYFGKDIPNMFMDYAGSQTKFAEGLSEGIHEEDGAGTSEDTKLLHNIN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagagaggagcttttctgaaatatttctccgtccagaccacgctgcagacggat
gaggtgaaaaacgtgccctgcggaaccagcggaggagtgatgatttattttgacagaatt
gaggtggtgaatttcctgatccaaagtgcagtgtatgacatagtgaagaactacaccgct
gactacgacaaagctctcattttcaacaagattcaccatgagctgaaccagttctgcagt
gtccacacgctgcaggaggtctacatcgagctgttcgatcagattgatgaaaaccttaaa
ctggcattgcagcaagacctaactaccatggcccccggattaattatacaggcagttcga
gttacaaagccaaacatccctgaaacaatccggaggaattatgagctcatggagagcgag
aagacaaagctactgattgcagcacagaagcagaaggtggtagagaaggaagcggagaca
gaaaggaagaaggccctcattgaggcagaaaaaattgcacaagttgctgaaataacttac
ggacagaaagtgatggaaaaagaaacagagaaacgaatttcagagatcgaagatgctgca
tttcttgcaagagagaaggcacgagctgatgctgaatgctatactgctatgaaagttgcc
gaggccaacaagatgaagttaactcctgagtacttacagctgatgaaatacaaggccatt
gcagcaaacagcaagatatattttggcaaagatatccccaacatgttcatggactatgca
ggtagccagactaaatttgcagagggactgtcagagggaatccacgaagaggatggggca
ggaaccagtgaggacacaaaattgcttcataacatcaactga

DBGET integrated database retrieval system