KEGG   Anser cygnoides domesticus (swan goose): 106044493Help
Entry
106044493         CDS       T04896                                 

Gene name
FKBP1B
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP1B
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:acyg03110]
    106044493 (FKBP1B)
Enzymes [BR:acyg01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106044493 (FKBP1B)
Chaperones and folding catalysts [BR:acyg03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    106044493 (FKBP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 106044493
NCBI-ProteinID: XP_013049984
Position
Unknown
AA seq 102 aa AA seqDB search
FPSTSQHFNLGVAQIETVLFWQGCRQNGKKFDSSRDRNKPFRFKIGRQEVIKGFEEGVTQ
MSLGQRAKLTCTPEMAYGATGHPGVIPPNATLLFDVELLRLE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
ttcccctccacctctcagcacttcaatttaggtgtagctcagattgaaactgtcttgttt
tggcagggctgcaggcagaatgggaagaagtttgattcctccagagacagaaacaagcct
ttcaggttcaagatcggcaggcaagaagtcattaagggatttgaagaaggtgttacacag
atgagcttaggacaaagagcaaagctgacctgcacacctgagatggcctacggagccacg
gggcaccccggggtcatccctcccaacgccaccctcctcttcgacgtggagctgctcagg
ttggagtga

DBGET integrated database retrieval system