KEGG   Anser cygnoides domesticus (swan goose): 106044860Help
Entry
106044860         CDS       T04896                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: arylamine N-acetyltransferase, liver isozyme-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00232  Caffeine metabolism
acyg00983  Drug metabolism - other enzymes
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    106044860
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    106044860
Enzymes [BR:acyg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     106044860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 106044860
NCBI-ProteinID: XP_013050505
Position
Unknown
AA seq 295 aa AA seqDB search
MNIQEYFARISYDGSHKDADLQTLTVIFQHHIQTIPFENLSMHCGETIDLDLQSIYNKIV
RKKRGGWCLESNYLLFWALKEIGYDVCILGGNSYDPAEKTYTAHINHILLXXXXXXDAYI
VDAGFGGAYQAWQPVMLISGKDQPQIPGIFCIREDNGIWYFEKVKRKHYISEQSVPPTNT
TEMGNIRKIYSFTLKPRHIDDFQELNTYLQVSPDNILRKKSICSLQTTEGIYALVGWTFT
EMKYNYMEDTDLLQITTLTDEEVEKTLKEKFNIVLENKLVPVNVRGLPPNMVDTI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaagagtatttcgcaagaatttcctacgatggctcccataaggatgcagac
ttgcaaaccttaacagtcatcttccagcatcacatccagacgattccttttgaaaacctc
agcatgcattgtggggagaccattgacctggatttacaatctatttacaataagattgtg
agaaagaaacgtggtggatggtgcctggaaagcaactaccttttattttgggccttgaaa
gaaatagggtatgacgtttgtattcttggaggaaatagttatgatccagcagagaagaca
tacactgctcacataaatcatatcctgctgnnnnnnnnnnnnnnnnnngatgcctatatt
gtagatgctggctttggtggtgcctatcaggcatggcagccggtgatgctgatttctggg
aaggatcaaccccagatccctggcatcttctgcatcagggaagacaacggcatctggtac
tttgagaaagtcaaaaggaagcattatatttctgagcaaagcgtccctcccactaataca
acagaaatgggcaatatcagaaaaatatattcattcactcttaagccacgccatatagat
gacttccaggagctaaacacatacctacaagtgtctccggataacatacttcggaagaag
tcaatctgcagcctccagaccactgaagggatttatgccttagtcgggtggaccttcact
gagatgaagtacaactacatggaggacacggacctcctgcagatcacaactcttacagac
gaagaggttgagaagacactgaaagaaaaattcaatatagtgctagaaaacaaactggta
ccagtaaacgttcgtggcttgccacctaatatggtggatacgatctaa

DBGET integrated database retrieval system