KEGG   Anser cygnoides domesticus (swan goose): 106045964Help
Entry
106045964         CDS       T04896                                 

Gene name
PLA2G4C
Definition
(RefSeq) cytosolic phospholipase A2 gamma
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00564  Glycerophospholipid metabolism
acyg00565  Ether lipid metabolism
acyg00590  Arachidonic acid metabolism
acyg00591  Linoleic acid metabolism
acyg00592  alpha-Linolenic acid metabolism
acyg01100  Metabolic pathways
acyg04010  MAPK signaling pathway
acyg04217  Necroptosis
acyg04270  Vascular smooth muscle contraction
acyg04370  VEGF signaling pathway
acyg04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106045964 (PLA2G4C)
   00565 Ether lipid metabolism
    106045964 (PLA2G4C)
   00590 Arachidonic acid metabolism
    106045964 (PLA2G4C)
   00591 Linoleic acid metabolism
    106045964 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    106045964 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106045964 (PLA2G4C)
   04370 VEGF signaling pathway
    106045964 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106045964 (PLA2G4C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106045964 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106045964 (PLA2G4C)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106045964 (PLA2G4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Na_Pi_cotrans ETC_C1_NDUFA4
Motif
Other DBs
NCBI-GeneID: 106045964
NCBI-ProteinID: XP_013052215
Position
Unknown
AA seq 504 aa AA seqDB search
MAWEEYRDAVQMSRDGIRKAKAQMELSLVNNEVRVSSDLSEGEIKATQKRRGRVQTCLLE
ELGVHCEENNVPNIVVLGSGGGLRAMIALLGTLVELKNQNILDAVMYLCGVSGSTWCMSM
LYTDSKWSEKLKSLEENLIKILTVDAWNIKKATEYLEESSEDEHYSLTDVWASCVVYKIL
HQFDENELTDHKDASETGINPYPIYAAVDKEKLHEKGASFPGTWFEFTPHEAGYTALGAF
VSTEHFGSKFEKGKLMENKNKKKHICYMQGLWGSALGSKEEILKAIHEDTTYRSVLQVHQ
FAQQLTQKGTQKKASSCIEDSIDTISNHSYTFMAWSLAPAANIQSSHLVKNKTISLIDAG
LAINSAYPLVLRAQRQTDLILSFDFSSGDPFETIEKAAEYCQKNGIAFPKIEKQETEKES
PSDCYIFRGDKSCPTVMHFPLFNKVNCSDKIKEYRSKFSTFKMSFPETDIKDLLAKAKLN
VSNNSKRILQEIQLLLCSSHTNKF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggaagagtacagggatgcagtccagatgagcagggatgggataaggaaagcc
aaggcacagatggaactgagcctggttaataatgaagttcgtgtgtctagtgatctctca
gaaggtgagataaaagccactcagaagagaagaggaagagtgcagacatgcctgcttgaa
gaacttggtgttcattgtgaggagaataatgtacctaacattgttgttctgggatcagga
ggaggcctgcgtgctatgatagccctgctaggaaccttggtggagctaaaaaatcagaat
atcttggatgctgtcatgtatctgtgtggtgtgtcaggatccacttggtgcatgtccatg
ctgtatacagattcaaaatggtcagaaaaattgaagtctctggaagagaatctgatcaaa
attctcactgtggacgcttggaatattaagaaggcaacagaatatttagaggagtcatca
gaagatgaacattactcactcactgatgtctgggcctcctgtgttgtatacaaaatactg
catcagtttgatgagaatgagctcactgatcacaaggatgcctcggagactggaataaac
ccttacccaatttatgcagcagtggataaggaaaaactgcatgaaaagggtgcaagcttt
ccagggacctggtttgaattcactccacatgaggctggatatactgccttgggcgctttt
gtgagtaccgagcactttggaagtaaatttgaaaaaggtaaactgatggagaataagaat
aagaagaaacacatttgttacatgcaaggcttatgggggagtgctcttggaagcaaggaa
gaaattctaaaggctatacatgaggacacaacttacagaagcgttctacaggtgcaccag
tttgcacagcagctcacacaaaagggcacacagaaaaaggccagcagctgtattgaggac
agcatcgacaccatcagcaaccacagctacacgttcatggcgtggtctctagcacctgct
gctaacattcagtcctctcacctggtcaaaaacaaaaccatctccttgattgatgctggc
ctggcaataaattctgcctatcctctggtacttagagcacagcgtcaaacagatctgatc
ctttcctttgacttcagctctggagatccttttgagactatcgagaaagcagctgaatac
tgccaaaaaaatggtattgcatttcccaagatagagaagcaggaaacggagaaagaaagc
ccttctgattgttacatctttcgaggagacaagtcatgccctacagtcatgcactttcca
ctcttcaacaaagtgaattgttctgataaaatcaaagaatacagaagtaaattctctact
tttaaaatgtccttccccgagacagacatcaaagatctccttgcaaaagcaaagctgaat
gtgtccaataatagtaagagaattttgcaagagatacaactgcttctatgttcctctcat
acaaacaagttctga

DBGET integrated database retrieval system