KEGG   Anser cygnoides domesticus (swan goose): 106046061Help
Entry
106046061         CDS       T04896                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04260  Cardiac muscle contraction
acyg04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106046061 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106046061 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    106046061 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acyg04040]
    106046061 (CACNG3)
Ion channels [BR:acyg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106046061 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 106046061
NCBI-ProteinID: XP_013052355
Position
Unknown
AA seq 219 aa AA seqDB search
PAGAVRASSIFPILSVGLLFFGGLCVAASEFYKSKHNVILSAGIFFVSAGLSNIIGIIVY
ISANAGDPGQSDSKKSYSYGWSFYFGALSFIIAEMVGVIAVHMYIEKHRQIRAKSHSELL
KRSAFTRLPTYRYRFRRRSSSRSTEPRSRDMSPVSKGFGTIPSTDISMFTLSRDPSKVTM
GTLLNSERDHGFLQVHNSIPKEFKESLHNNPANRRTTPV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
cccgcaggtgcggtgagagcctccagcatcttccccatcctcagcgtgggtctgctcttc
ttcggcggcctgtgcgtggcggccagcgagttctacaagagcaaacacaacgtcatcctc
agcgccggcatcttcttcgtctcggcaggtctcagtaacatcatcgggatcatcgtctac
atctcggcaaacgcgggggacccagggcagagcgactccaagaagagctactcctacggc
tggtccttctacttcggcgcgctgtccttcatcatcgccgagatggtgggggtgatcgcc
gtgcacatgtacatcgagaagcaccgccagatccgcgccaagtcgcactcagagctgctg
aagaggtcggccttcacccgcctccccacctaccggtaccgcttccgccggcggtccagc
tcccgctccaccgagccgcggtcccgggacatgtcgcccgtcagcaagggcttcggcacc
atcccctccaccgacatctccatgttcaccctctccagggatccctccaaggtcaccatg
gggacactgctcaactccgagcgggaccacggttttttacaggtccataactccatcccc
aaagagttcaaggagtctttgcacaacaacccggccaacagacgaaccacgccggtctga

DBGET integrated database retrieval system