KEGG   Anser cygnoides domesticus (swan goose): 106047917Help
Entry
106047917         CDS       T04896                                 

Gene name
ZDHHC18
Definition
(RefSeq) palmitoyltransferase ZDHHC18 isoform X1
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
Enzymes [BR:acyg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106047917 (ZDHHC18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC HRG
Motif
Other DBs
NCBI-GeneID: 106047917
NCBI-ProteinID: XP_013055088
Position
Unknown
AA seq 249 aa AA seqDB search
MGTSTYRPPARTMEVVINKYVVKLKYCYTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGN
CVGKRNYRYFYAFILSLSFLTAFIFACVVTHLTLRSQRDGFLTTLKTTPASVLELVICFF
SVWSILGLSGFHTYLVASNLTTNEDIKGSWSNKRGSEFANPYSHKSILTNCCAVLCGPFH
PSLIDRRGFIQPDVGTPSSPKSEVPSFGAKPDTSMALRCVTSGVFPRRTPARTLPFPAQP
DGMCPLLGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctctacctaccgcccgcccgcccgcacgatggaggtggtcatcaacaagtac
gtggtgaagctcaagtactgctacacctgcaagatgttccgcccgccgcgcacctcgcac
tgcagcgtctgcgacaactgcgtcgagaggttcgatcaccactgcccctgggtgggcaac
tgcgtggggaagcgcaactaccgctacttctacgccttcatcctctccctctccttcctg
acagccttcatcttcgcctgtgtcgtcacccacctcactctgcgctcgcagagggatggc
ttcctcaccaccctgaagacaacacccgcgagcgtgctggagctggtcatttgtttcttc
tcagtctggtctattttgggcctctcaggttttcacacttacttagtcgcctccaacctg
acgacgaacgaagacatcaaagggtcctggtcaaataagaggggctcagagtttgccaat
ccttacagccataaaagtatcctcacaaactgctgcgcggtgctgtgtggcccgttccat
cccagtttgatagacagaagaggatttatccagccagatgtcgggaccccgtccagcccg
aagagcgaagtcccttccttcggagccaagcctgacaccagcatggcgctgcggtgcgta
acctctggtgtcttccccaggaggacgcctgccaggactttgccatttcctgcacagcct
gacgggatgtgccccctcctgggacgttag

DBGET integrated database retrieval system