KEGG   Anser cygnoides domesticus (swan goose): 106048834
Entry
106048834         CDS       T04896                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acyg01002]
    106048834 (ERAP1)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     106048834 (ERAP1)
Peptidases and inhibitors [BR:acyg01002]
 Metallo peptidases
  Family M1
   106048834 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 106048834
NCBI-ProteinID: XP_013056390
Position
Unknown
AA seq 931 aa
MAGPRPAASFRGPSVPVVSVVLGLAVVASSVGGGLGADSSAPFPWDRVRLPEHVVPLHYH
LLIHPNLTTQTFSGTAAIDLTVTRQTSAVILHSKRLRVAWAAIGAQEARVLEHRALEQVA
LLATEPLQAGHNYTVTIQYAANLSDSFHGFYKSTYRTQEGELRVLAATHFEPTFARMAFP
CFDEPAFKARFSVKIRREPKHLALSNMPLMKTVNINSWLVEDHFDTSVKMSTYLVAFIVS
DFKSISKISSHGVKISVYTVPEKIHQADYALDAAVKLLDFYEDYFSISYPLPKQDLAAIP
DFQSGAMENWGLTTYRESALLYDPEKSSASSRLWITMIIAHELAHQWFGNLVTMEWWNDL
WLNEGFAKFMEFVSVNVTHPELKVEDYFLTRCFDAMEVDALNSSHPVSTPVEDPAQILEM
FDDVSYEKGSCILNMLRDYLTDNGFKAGLVQYLQKYSYQNTKNEDLWDSMTNICPTVGSD
KSEQQGDGFCRRNQQSSSNAHWTKGETLDVRAMMNTWTLQKGFPLVTVTVRGKNVHLQQE
HYMKGADSHPSTGYLWHIPLTYITSKSDTVQRFLMTTKTDVIILPEEVEWIKFNVYMNGY
YIVHYEDDGWDHLINLLKENHTAISNNDRASLINNIFQLVRIKKLPISKAFDLTLYLKRE
TQIMPVLQGMNELIPIYKLMEKRDMEDTEKQLKEYIVNLFKDLIDKQLWSDDGSVSERML
RQSLLLFACMRRYQPCVDKAEEYFLKWQKSNGTLRLPADVKTAVYAVGAQTSEGWDFLLS
KYRQHSFSIDKSKIELALSLTRNKDKLQWLLDQGLRGDIIKTQDLPYIIVYVARNPSGYH
LAWTFLKENWEKVVEKFELGSHSIATIVTGVTNQYSTRPQLAQVKEFFSSLEEKSAQLRC
IHQAIETIEDNIQWMDRNFEDIKIWLQKNHL
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggcagggccgcgcccggccgcctcgttccggggcccgtctgtcccagtggtgtccgtg
gtgctgggcctggccgtggtggcttcttctgtcggtggtggcctcggcgctgacagcagc
gcgccgtttccctgggacagggtgaggctccccgagcacgttgtcccgctgcactaccac
ctcctcatccaccctaacctcaccacgcagaccttctcggggacagctgccatagacctg
accgtcacccgtcaaaccagcgccgtcatcctgcacagcaagcgtttgcgtgtggcctgg
gcggccatcggggcgcaggaagcgagggtgctggagcaccgggcgctggagcaggtggca
ctgctcgccaccgagccgctgcaggctggccacaactacaccgtcaccatccagtacgct
gccaacctctccgactccttccatggcttttacaaaagcacctacaggacccaggaggga
gaactcagagtgcttgcagcaacgcattttgagccaacatttgcaagaatggccttccca
tgtttcgatgaaccagccttcaaagccagattttcagttaagattaggagggaaccaaag
cacctcgcgctgtccaatatgccacttatgaagactgtgaatataaattcatggcttgtt
gaagaccattttgataccagcgtcaagatgagtacctacctcgtggcctttattgtttca
gatttcaagtccatcagcaaaatatccagtcatggagttaagatttctgtatacacggta
ccagagaagatccaccaagctgattatgcactggatgcagcagtaaaacttttagacttt
tatgaggattacttcagcatttcatatcccttacctaaacaagatttagcagctattccg
gatttccagtctggtgctatggaaaactggggattgaccacatatcgggaatctgcgttg
ttgtatgaccctgagaagtcctcagcatcttctagactttggattactatgataatagcc
catgaactggctcatcagtggtttggcaacctagttaccatggagtggtggaatgacctg
tggttaaatgaagggtttgcaaaattcatggagttcgtgtcggtcaacgttacccatcca
gaactgaaagttgaagattatttcttaacaagatgctttgatgccatggaagtggatgca
ttaaattcatcgcatcctgtgtctactcctgtggaagatccagctcaaattttagaaatg
tttgatgatgtttcttatgagaagggatcctgtatattaaatatgttgagggactacctg
actgacaatggttttaaagctggacttgtgcagtacctgcagaagtacagctatcagaat
acaaaaaatgaagatttgtgggacagtatgacaaatatttgtcccacagtaggtagcgat
aagagtgaacaacaaggtgatggcttttgcagaaggaaccaacagtcatcctcaaatgca
cactggactaaaggagagactcttgatgtgagggcaatgatgaacacttggacactgcaa
aaaggttttcccctggtaactgtcacagtgagaggaaagaacgtccacctgcagcaggag
cactacatgaagggcgcagattcccatccatccacagggtacttgtggcacattccacta
acctacattacgagcaaatctgacactgtgcaaagatttttgatgacaactaaaacagat
gtcattatccttccggaagaggttgagtggatcaaattcaatgtgtacatgaatggttat
tacattgtgcactatgaagatgacggatgggatcatctgatcaaccttttgaaagagaac
catacagcgattagcaacaatgacagagcaagtctcattaacaacatattccagcttgta
agaataaaaaaattgccaatttctaaagcttttgatttaactttatacctgaaacgggaa
acacaaatcatgcctgtactccaaggtatgaatgagctgattcctatatacaagctgatg
gagaagcgggatatggaagatacagaaaaacagttaaaggagtatatagtcaatttattt
aaagacctaattgacaaacagctttggagtgatgacggctcagtgtctgagagaatgctt
cggcagtccctgctgctcttcgcatgtatgcgcagataccagccgtgcgtggacaaagca
gaagagtatttcttgaaatggcagaaatccaatggaaccttgaggttgccagctgatgtg
aagacagcagtgtatgctgttggagcacaaacatctgaaggttgggatttcctccttagt
aaatacagacagcactcattcagcatagataaaagtaaaattgaattagctctcagcctc
accagaaataaggacaaacttcagtggttactggaccaaggtctccgtggtgacatcata
aaaactcaggatcttccatacattattgtgtatgttgccagaaacccatctggctatcac
cttgcttggacgtttttaaaggaaaattgggagaaagtcgtagaaaaatttgaactcggt
tcacattccatagcgaccattgtcactggagtgacaaatcagtactcaactaggccacag
cttgcacaggttaaagaattcttcagttctctggaggaaaaaagtgcacagcttcgttgc
atccaccaagctattgaaaccattgaggacaatatacaatggatggatagaaattttgag
gatatcaaaatatggctgcaaaagaatcacctataa

DBGET integrated database retrieval system