KEGG   Acidithiobacillus caldus ATCC 51756: Acaty_c1088Help
Entry
Acaty_c1088       CDS       T03561                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
acz  Acidithiobacillus caldus ATCC 51756
Pathway
acz00430  Taurine and hypotaurine metabolism
acz00620  Pyruvate metabolism
acz00640  Propanoate metabolism
acz00680  Methane metabolism
acz01100  Metabolic pathways
acz01120  Microbial metabolism in diverse environments
acz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acaty_c1088
   00640 Propanoate metabolism
    Acaty_c1088
  09102 Energy metabolism
   00680 Methane metabolism
    Acaty_c1088
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Acaty_c1088
Enzymes [BR:acz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Acaty_c1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AIA54958
UniProt: A0A059ZTZ1
Position
complement(1080806..1081984)
Genome map
AA seq 392 aa AA seqDB search
MAGLGSTVLCINSGSSSLKFAVYAVPVADSGQCLAEGAIERIGQSVGRLWIQTPNEERRE
EQAPFPDANAALTTLFRSLESLSYPPPAAVGHRIVAGGPRHTNHIRVDERVLQDLREALP
FAPLHLPAEIAAIEAVRRHWPEIPQVACFDTAFHRDIPELAARFPLPRNLWHEGVRKYGF
HGLSYEYILSQLTDGGRGRLIVAHLGNGASLAAIADGRCLDTSMGLTPTGGLVMGTRSGD
LDPGVLLYLIAEKGYTGPQLERLLNRLSGMLGISGVSGDVQTLLAERGQNAHAAQALEIF
AYSVRKGIGAFMAVLGGLDRLVFTGGIGEHAAPLRWSICRPLEDLGIRLDPQANGESRRR
ISRADSPVEVLVIPTNEDLTIARHTQDIAQIV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggctggattaggctcgacggtcctgtgcatcaatagcggctcgtcctccctcaagttt
gccgtctatgccgtacccgtcgccgactcgggccagtgcctcgccgaaggtgccatcgag
cgcatcggtcagagtgtgggccggctctggattcagacccccaacgaggagcggcgggag
gaacaggcccccttccccgacgcgaatgctgccctgaccacgctcttccgcagcctggaa
agcctctcctacccgccaccggcggccgtcggacaccgcatcgtcgccggcggaccccgg
cacacgaatcacattcgtgtcgacgagcgtgtcctccaggatctgcgcgaggctttacct
tttgcgcccttgcatctgccagccgaaatcgccgccatcgaagccgtacggcgccactgg
cccgaaatcccccaggtcgcctgctttgacaccgccttccaccgcgacatccccgagctc
gccgcccgtttccccctaccccgcaacctctggcacgaaggcgtacgcaagtacggcttc
cacggcctctcgtacgagtacatcctttcccagctgacggacggcggtcgcggacgcctc
atcgtcgcccacctcggcaatggtgccagtctcgccgccattgccgacggtcgctgcctg
gacaccagcatggggctcacgcccaccgggggcttggtcatggggacgcgcagcggcgat
ctcgaccccggcgtcctactttacctcattgccgaaaaaggctacaccggaccacagttg
gagcgccttctcaaccgcctctcggggatgctgggtatctccggagtcagcggcgacgtg
caaaccttgctggccgaacgggggcagaacgcgcacgcggcccaggccttggagattttt
gcctacagcgtgcgcaagggtatcggtgccttcatggccgtcctcggcggtctcgatcgc
ctggtcttcacgggcggtatcggcgaacacgccgcccccctgcgctggtccatctgtcgc
cccctggaggatctgggcatccgcctcgacccacaggccaatggcgaatctcgccggcgc
atctcccgggcggacagccccgtggaagtcctggtgatccccaccaacgaagacctcacc
attgcccgccacacccaggatatcgcccagatcgtctga

DBGET integrated database retrieval system