KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0942Help
Entry
Adeh_0942         CDS       T00326                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00260  Glycine, serine and threonine metabolism
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ade00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeh_0942
Enzymes [BR:ade01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Adeh_0942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABC80717
UniProt: Q2IPI6
Position
complement(1089947..1091032)
Genome map
AA seq 361 aa AA seqDB search
MNPGTPSHPASPAPSGPLRHFASDNYGGICPEAFAAMAEANVGHSPGYGDDRWTQEAADL
LRETFETDCEVFFAFNGTAANSLALAALCQSYHSILCHETAHVETDECGAPEFFSNGTKV
LTLPGPNGKLRPDGIDHMVRRRSDIHYPKPRVVSVTLPTELGTLYTVDELRAIGERARAH
GLRFHMDGSRFGNAVAALGVAPKDLTWKVGVDVLCFGGTKAGMAVGEAIVFFDRALAADF
DYRCKQAGQLASKMRFLAAPWVGMLRGGAWLRHARHTNAMAALLERALRAVPGVEILQPV
QANSVFATLPGDAAAQLRAKGWRFYDFIGSGGVRLMCAWDVTPADVEAFASDLRLAVAGR
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccggcaccccgtcccaccccgcgtcccccgccccctcgggcccgctgcgccac
ttcgcctccgacaactacggcggcatctgccccgaggcgttcgcggccatggccgaggcg
aacgtgggccactcgccgggctacggcgacgaccgctggacgcaggaggcggcggacctg
ctgcgggagacgttcgagaccgactgcgaggtgttcttcgcgttcaacggcaccgccgcg
aactcgctggcgctggcggcgctctgccagtcctaccactcgatcctctgccacgagacg
gcgcacgtcgagaccgacgagtgcggcgcgccggagttcttctcgaacggcaccaaggtg
ctcaccctgcccggcccgaacggcaagctccgcccggacggcatcgaccacatggtccgg
cgccgcagcgacatccactacccgaagccgcgggtggtctcggtgacgctgccgaccgag
ctgggcacgctctacacggtggacgagctccgcgcgatcggcgagcgcgcccgcgcccac
ggcctgcgcttccacatggacggctcgcgcttcggcaacgccgtggccgccctgggggtc
gcccccaaggacctcacctggaaggtgggcgtggacgtgctctgcttcggcgggaccaag
gccggcatggcggtgggcgaggcgatcgtgttcttcgaccgcgcgctggcggcggacttc
gactaccggtgcaagcaggcagggcagctcgcgagcaagatgcgcttcctggcggcgccg
tgggtgggcatgctccggggcggcgcctggctgcgccacgcccggcacaccaacgccatg
gcggcgctgctggagcgcgcgctccgcgccgtcccaggggtggagatcctccagccggtg
caggcgaactcggtgttcgcgacgctgccgggggacgccgccgcgcagctgcgcgcgaag
ggctggcgcttctacgacttcatcggctcgggcggcgtccggctcatgtgcgcctgggac
gtgacccccgccgacgtggaggcgttcgcctccgatctccggctggcggtggccggccgg
tcctag

DBGET integrated database retrieval system