KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1509Help
Entry
Adeh_1509         CDS       T00326                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00564  Glycerophospholipid metabolism
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
Module
ade_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ade00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Adeh_1509
Enzymes [BR:ade01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Adeh_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ABC81282
UniProt: Q2II03
Position
1735145..1736068
Genome map
AA seq 307 aa AA seqDB search
MARGPAGRTAKNGARRGRPLLDSARSMNDRLFISALRLLPKNALSRAVGALTRWRAPLPV
RLAAMRAFARRYGIDLSECPDLDVYRTFGEFFARPLRPGLRPVAPGERVLVSPVDGVVSE
TGRAEAGRLVQAKGIDYPAAALLGDDALAARLAGGAYATLYLSPKDYHRIHFPLGGRVTG
WRYVPGKLWPVNPASVRTVPGLFALNERLVTVLETPLGACAVVAVGATVVGRVCAYYDPS
IPFTNLAGAAPRRHDYPTPIPVEKGQELGAFEMGSTVILLFEPGKVRLDPRLAPGARVRV
GEPLGGA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgggggccggccggccgcaccgcgaaaaacggggcccgccgcggccggccgctg
ctagactccgcgcgctccatgaacgaccgcctgttcatctccgccctgcggctcctgccc
aagaacgccctctcgcgcgccgtcggcgcgctcacccgctggcgcgcgccgctccccgtg
cggctcgccgccatgcgggcgttcgcgcggcgctacggcatcgacctgtcggagtgcccg
gacctcgacgtgtaccggacgttcggcgagttcttcgcgcgcccgctgcggcccgggctg
cggcccgtcgcgcccggcgagcgggtgctggtgtcaccggtggacggcgtcgtgtccgag
accggccgcgccgaggccggccggctggtgcaggcgaagggcatcgactacccggccgcc
gcgctgctgggcgacgacgcgctcgccgcgcggctggcgggcggcgcctacgcgacgctg
tacctctcgcccaaggactaccaccgcatccacttcccgctgggcgggcgggtgaccggc
tggcgctacgtgccggggaagctctggccggtgaacccggcctcggtccggacggtgccc
ggcctgttcgcgctgaacgagcggctggtgaccgtcctggagacgccgctcggcgcctgc
gcggtggtggcggtgggggccacggtggtgggccgggtgtgcgcctactacgacccgtcc
atcccgttcaccaacctggcgggcgcggcgccgcgccgccacgactacccgacgcccatc
ccggtggagaaggggcaggagctgggggcgttcgagatgggctccacggtgatcctgctc
ttcgagccgggaaaggtccggctcgacccgcggctcgcgcccggggcgcgggtccgggtg
ggcgagccgctcggcggcgcctag

DBGET integrated database retrieval system