KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1825Help
Entry
Adeh_1825         CDS       T00326                                 

Definition
(GenBank) pyruvate dehydrogenase-like complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00010  Glycolysis / Gluconeogenesis
ade00020  Citrate cycle (TCA cycle)
ade00620  Pyruvate metabolism
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01200  Carbon metabolism
Module
ade_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_1825
   00020 Citrate cycle (TCA cycle)
    Adeh_1825
   00620 Pyruvate metabolism
    Adeh_1825
Enzymes [BR:ade01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Adeh_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF829
Motif
Other DBs
NCBI-ProteinID: ABC81597
UniProt: Q2IIW9
Position
complement(2086184..2087512)
Genome map
AA seq 442 aa AA seqDB search
MAYKLELPDIGEGVVEAEVQQWFVAPGDAITEDQPLVEVMTDKATVVIPSPKRGTVVKLF
WKVGDVAKVHSPLVEIELDDAPPRPAPEAPVRAATAAATAQAAAAASVAVGRPAQAEPPA
AAAAPAAAAGPAGAKALATPAVRAMARELGIDVNTVPGTGPGGRVTKDDLSRARGKVNGH
GGETQVPAAPAPAAARAPVPAPAPSAAPEADERIPLRGMRRKIAENMARSKRTAAHFTFV
EQADVTELVRVKERIAAAAKEEGVKVTFLPFVVKAVVAALRKFPKLNASLDDERGEIVLK
RRYDVGVASATDAGLVVPVLRAADRRSLLDLAREIERLSQDTKAGRIRPEDLGNSTFTIT
SLGALGGLFATPVLNHPEVGILGIHRIRPTPVVRDGQIVARDVMHVSLTSDHRVVDGHEA
AAFTYQVIKYLEDPNLLFMQMV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaagctcgagctccccgacatcggcgagggggtcgtcgaggcggaggtccag
cagtggttcgtcgcccccggcgacgcgatcaccgaggaccagccgctcgtcgaggtgatg
accgacaaggcgacggtggtgatcccgtcgccgaagcgcggcacggtggtgaagctgttc
tggaaggtgggcgacgtcgccaaggtgcactcgccgctcgtcgagatcgaactcgacgac
gcgccgccgcgcccggcgcccgaggccccggtgcgcgccgccaccgcggcggcgacggcc
caggcggccgcggcggcgagcgtcgccgtgggccggccggcccaggccgagccgcccgcg
gcggcggcggcccccgcggcggcggccgggcccgcgggcgcgaaggcgctcgccaccccc
gccgtgcgcgccatggcgagggagctcggcatcgacgtgaacacggtgccgggcaccggc
cccggcggccgcgtcaccaaggacgacctgtcgcgcgcgcgcggcaaggtgaacgggcac
ggcggcgagacgcaggtgcccgcggcgcccgcgcccgccgcggcgcgcgcgccggtcccc
gcgccggcgccgtccgctgccccggaggcggacgagcggatccccctccgcggcatgcgg
cggaagatcgccgagaacatggcgcggtcgaagcggaccgccgcccacttcacgttcgtg
gagcaggcggacgtcaccgagctggtccgggtgaaggagcggatcgccgccgccgcgaag
gaggagggcgtcaaggtcacgttcctgccgttcgtggtgaaggcggtggtggccgcgctg
cgcaagttcccgaagctgaacgcgtcgctcgacgacgagcgcggcgagatcgtgctgaag
cgccggtacgacgtcggcgtcgcctcggccaccgacgcggggctggtggtcccggtgctc
cgcgccgccgaccgccgctcgctcctcgacctcgcccgcgagatcgagcggctctcccag
gacaccaaggccggccgcatccgccccgaggacctgggcaactccacgttcaccatcacc
agcctgggcgcgctgggcgggctgttcgccaccccggtgctgaaccaccccgaggtcggc
atcctgggcatccaccgcatccggcccacgccggtggtgcgcgacgggcagatcgtcgcg
cgcgacgtgatgcacgtctcgctgacgagcgatcaccgcgtggtggacgggcacgaggcg
gccgcgttcacctaccaggtgatcaagtacctcgaggatccgaacctcctgttcatgcag
atggtgtga

DBGET integrated database retrieval system