KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2047Help
Entry
Adeh_2047         CDS       T00326                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00010  Glycolysis / Gluconeogenesis
ade00620  Pyruvate metabolism
ade00640  Propanoate metabolism
ade00680  Methane metabolism
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_2047
   00620 Pyruvate metabolism
    Adeh_2047
   00640 Propanoate metabolism
    Adeh_2047
  Energy metabolism
   00680 Methane metabolism
    Adeh_2047
Enzymes [BR:ade01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Adeh_2047
Lipid biosynthesis proteins [BR:ade01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Adeh_2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABC81817
UniProt: Q2IJI9
Position
complement(2300608..2302563)
Genome map
AA seq 651 aa AA seqDB search
MATETADPRFPDLTEAQRAAIEALSTDERTIKAPVWLAQRAHVANDAVERAFAQEEPEAF
WREKAKLVDWMRPFEEVMRFDPPRHEWFVGGKLNASVNCIDRHVFGDRRLKAALIWVGED
GEEHTYTYNRLYREVGRFGNALRKLGVKKGDRVIIYMPLTPEGIISMLACARIGAIHSVV
FAGMGTQALRSRIEDSAAKVVICSDFTLRRGKKIPLKPTVDEAVRDLYSVEHVVVHRRGS
RPGDAPFTFESEREHDFYDVQDAAAIHCPPEPMDAEDPLFILYTSGTTGKPKGVVHTTGG
YLVGTTYLARAYYQIGDKDIYWSTSDIGWIVGHSFIVYGPLSVGATIFTREGVPDYPSPE
VTWELCERYGVDVMFTAPTAVRMWMSHGGDAPAKYDLRKLRLIACAGEPLNPEAHHWAQQ
HLVGQSKGMVVDNWWQTEIAAPVLGTLPTFDARPGKVGKPMPGADVAILDQGGEPVPEGQ
GGLLVIRKPLPYMLRTVWNDHARYEKYWTQIPGVYTAGDIAVKDRDGYFAVLGRADDVLN
VAGHRIGTADVEGSLLRHPAVAESAVVGLPDPVKGERIKAYVVLRKGVPQGPGVIGSLKD
HVRQDLGPIATPSDVELRATLPKTRSGKIMRRYLKAVEMGQDPGDVSTMAD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgagaccgctgatcccaggttccccgatctcaccgaggcgcagcgcgccgcc
atcgaggcgctgtccacggacgaacgcaccatcaaggcgccggtgtggctcgcgcagcgg
gcccacgtcgcgaacgacgccgtcgagcgcgcgttcgcgcaggaggagccagaggcgttc
tggcgcgagaaggcgaagctcgtggactggatgcggccgttcgaggaggtgatgcgcttc
gacccgccgcgccacgagtggttcgtgggcgggaagctgaacgcctccgtcaactgcatc
gaccgccacgtgttcggcgatcgccgcctcaaggccgcgctgatctgggtcggcgaggac
ggcgaggagcacacgtacacgtacaaccggctctaccgcgaggtgggccgcttcgggaac
gcgctccgcaagctgggcgtgaagaagggcgaccgcgtcatcatctacatgccgctcacg
ccggagggcatcatctcgatgctcgcgtgcgcgcgcatcggcgccatccactcggtggtg
ttcgccggcatgggcacgcaggcgctgcgcagccgcatcgaggactccgccgccaaggtc
gtcatctgctcggacttcacgctgcggcgcgggaagaagatcccgctgaagcccaccgtg
gacgaggcggtgcgcgacctgtactcggtggagcacgtggtggtgcaccggcgcggctcg
cggcccggcgacgcgccgttcacgttcgagtcggagcgcgagcacgacttctacgacgtg
caggacgcggcggccatccactgcccgcccgagccgatggacgcggaggacccgctgttc
atcctctacacgtccggcaccaccgggaagccgaagggcgtggtccacaccaccggcggc
tacctggtcggcaccacgtacctggcgcgcgcctactaccagatcggcgacaaggacatc
tactggtccacctcggacatcgggtggatcgtcggccactcgttcatcgtgtacgggccg
ctgtccgtcggcgcgaccatcttcacgcgcgagggcgtgccggactacccgtcgcccgag
gtgacctgggagctgtgcgagcgctacggcgtggacgtcatgttcaccgcgcccaccgcg
gtgcgcatgtggatgagccacggcggcgacgcgccggccaagtacgacctgcgcaagctg
cggctcatcgcgtgcgccggcgagccgctcaacccggaggcgcaccactgggcgcagcag
cacctggtgggccagtcgaagggtatggtggtggacaactggtggcagaccgagatcgcc
gccccggtgctcgggacgctgcccacgttcgacgcgcggccgggcaaggtgggcaagccc
atgcccggcgccgacgtcgccatcctggatcagggcggggagccggtgcccgaggggcag
ggcgggctgctcgtgatccgcaagccgctcccgtacatgctgcgcacggtgtggaacgac
cacgcccgctacgagaagtactggacgcagatccccggggtctacacggcgggtgacatc
gcggtgaaggaccgcgacggctacttcgccgtgctcgggcgcgccgacgacgtgctgaac
gtggccggccaccgcatcggcaccgccgacgtggagggttcgctgctccgccacccggcg
gtggccgagagcgcggtggtgggcctgcccgacccggtgaagggcgagcggatcaaggcg
tacgtggtgctccgcaagggcgtcccccagggccccggcgtcatcggctcgctgaaggac
cacgtccgccaggacctcggccccatcgcgaccccgtccgacgtcgagctccgcgccacg
ctgccgaagacgcgctccggcaagatcatgcggcgctacctgaaggccgtcgagatgggc
caggaccccggcgacgtctcgaccatggccgactga

DBGET integrated database retrieval system