KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2365Help
Entry
Adeh_2365         CDS       T00326                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00071  Fatty acid degradation
ade00072  Synthesis and degradation of ketone bodies
ade00280  Valine, leucine and isoleucine degradation
ade00310  Lysine degradation
ade00362  Benzoate degradation
ade00380  Tryptophan metabolism
ade00620  Pyruvate metabolism
ade00630  Glyoxylate and dicarboxylate metabolism
ade00640  Propanoate metabolism
ade00650  Butanoate metabolism
ade00900  Terpenoid backbone biosynthesis
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01200  Carbon metabolism
ade01212  Fatty acid metabolism
ade02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ade00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Adeh_2365
   00630 Glyoxylate and dicarboxylate metabolism
    Adeh_2365
   00640 Propanoate metabolism
    Adeh_2365
   00650 Butanoate metabolism
    Adeh_2365
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Adeh_2365
   00072 Synthesis and degradation of ketone bodies
    Adeh_2365
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Adeh_2365
   00310 Lysine degradation
    Adeh_2365
   00380 Tryptophan metabolism
    Adeh_2365
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Adeh_2365
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Adeh_2365
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Adeh_2365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ade04147]
    Adeh_2365
Enzymes [BR:ade01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Adeh_2365
Exosome [BR:ade04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Adeh_2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABC82135
UniProt: Q2IKF8
Position
complement(2668980..2670161)
Genome map
AA seq 393 aa AA seqDB search
MTGREVVIVGAARTPIGSFLGSLASVTAPRLGAVAIRAALARAGVEPSAVDEVVMGNVLQ
AGEGQAPARQAAIYAGLPEKTPAWTLNKVCGSGLKAVISAAQAIALGDADVVVAGGMESM
SNVPYYDRTARTGARMGNVELVDGMIHDGLWDVYGQQHMGMCAEHCATTQGISRAAQDEY
AIESTRRAVEAWKAGAFKAEIVPVEIEGKKGEKTVVSEDDGPKGARPEKIPSLRPSFKKD
GTVTAASSSSINDGAAALVLASAERAAREGLPVLGRLRAWGGAARAPVEFTIAPADAIRT
TLAKARLQVSDVDLWEINEAFAVVSIANNALLGLDSRKVNVRGGAVVLGHPIGASGARIL
VTLLQAMKDLDRRRGVASLCIGGGEAVAVVVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacgcgaagtggtcatcgtcggggcggcgcgcacgcccatcggctccttcctc
ggctcgctcgcctccgtcaccgccccgcgcctcggcgcggtggccatccgcgccgcgctc
gcgcgcgccggcgtggagccctcggcggtggacgaggtggtgatgggcaacgtgctccag
gcgggcgaggggcaggccccggcccggcaggccgcgatctacgcgggcctcccggagaag
acgcccgcctggacgctcaacaaggtgtgcggctccgggctgaaggcggtgatctccgcc
gcgcaggccatcgcgctcggcgacgccgacgtggtggtggcgggcggcatggagtcgatg
tcgaacgtgccgtactacgatcggaccgcgcggaccggcgcgcggatgggcaacgtggag
ctcgtggacggcatgatccacgacggcctctgggacgtgtacggccagcagcacatgggc
atgtgcgccgagcactgcgccaccacccaggggatctcccgcgccgcgcaggacgagtac
gcgatcgagtccacccgccgcgccgtcgaggcgtggaaggcgggggcgttcaaggccgag
atcgtcccggtggagatcgagggcaagaagggcgagaagacggtcgtgagcgaggacgac
gggccgaagggcgcgcgcccggagaagatcccttcgctccggccctcgttcaagaaggac
ggcaccgtcaccgccgccagctcctcgtccatcaacgacggcgcggcggcgctggtgctc
gcgagcgccgagcgggccgcgcgcgaggggctgccggtgctcgggcgcctgcgcgcctgg
ggcggcgccgcgcgggcgccggtggagttcaccatcgccccggcggacgcgatccggacc
acgctggcgaaggcgcggctccaggtctcggacgtggacctgtgggagatcaacgaggcg
ttcgcagtggtctcgatcgccaacaacgcgctgctcggcctcgactcgcgcaaggtgaac
gtgcgcggcggcgcggtggtgctcggtcaccccatcggcgcgtccggcgcgcgcatcctg
gtgacgctgctccaggccatgaaggacctcgatcgccggcgcggcgtcgcctcgctctgc
atcggcggcggcgaggcggtcgcggtggtggtggagcggtag

DBGET integrated database retrieval system