KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2800Help
Entry
Adeh_2800         CDS       T00326                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00360  Phenylalanine metabolism
ade00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ade00790  Folate biosynthesis
ade01100  Metabolic pathways
ade01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ade00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Adeh_2800
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Adeh_2800
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Adeh_2800
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Adeh_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H UBM
Motif
Other DBs
NCBI-ProteinID: ABC82570
UniProt: Q2ILP1
Position
complement(3172915..3174504)
Genome map
AA seq 529 aa AA seqDB search
MGPTERAIAELPPHLRRFVVAQDHAAYTPRDHAVWRHVLRRLTAHLATRAHPRYLAGLAA
TGIEVERIPSLDEMNRKLARVGWSAVAVRGFIPPAVFTELQSRRVLAIAADIRTHEHIEY
TPAPDIIHESAGHAPFIADPTYAEYLRRAGEVGFRAIASAEDQAVFEAIRNLSVVKEDPE
ASEEEVALSEARLRAASASVRYASESTRASRLYWWTAEYGLVGTLDDPRIYGAGLLSSIG
EAVHCLTPAVRKLPLDPGCADVAYDITRMQPQLFVARDFDQLFEVLDAFDAGLSWRRGGD
RGLEEARRARTVNHLALSGGRELTGKVAERIPAATEIAPGLSTALVRLDGPVLVSRDGRA
EGKPWPGEVVVAFGDAAVPERGPFDLALPGGLALRGFAVGGGEVVDLRATRDGRPLELPT
WALLFVSRDLRSVAGGPADPGAWDRWFGEHGTFTAGEGEARARARKAKALPPALAALYDE
VRRLRETGRATRERLLAIREAAAAFPGDWLLRAEVDELLAPGAEAGAHP
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccaccgagcgcgccatcgccgagctgccgccgcacctccgccgcttcgtggtc
gcgcaggatcacgccgcgtacacgccgcgcgaccacgcggtctggcgccacgtcctccgg
cggctcaccgcccacctggccacccgcgcccacccccgctacctggccggcctggccgcc
accggtatcgaggtggagcgcatcccgagcctcgacgagatgaaccggaagctggcgcgg
gtggggtggtcggcggtggcggtgcgcgggttcatcccgcccgcggtgttcaccgagctc
cagagccggcgcgtgctggccatcgccgccgacatccgcacccacgagcacatcgagtac
acgcccgcgcccgacatcatccacgagagcgccggccacgcgccgttcatcgccgacccg
acctacgccgagtacctgcggcgggccggcgaggtggggttccgcgccatcgcgtccgcc
gaggaccaggcggtgttcgaggccatccgcaacctctccgtggtgaaggaggacccggag
gcgagcgaggaggaggtggcgctctccgaggcgcggctccgggccgcgtcggcgagcgtg
cgctacgcctcggagtccacgcgcgcgagccggctctactggtggaccgcggagtacggc
ctggtgggcacgctcgacgatccgaggatctacggcgcgggcctgctctcctcgatcggc
gaggccgtgcactgcctcacgcccgcggtgcgcaagctgccgctcgacccgggctgcgcc
gacgtcgcctacgacatcacccgcatgcagccgcagctgttcgtggcccgcgacttcgac
cagctcttcgaggtgctggacgcgttcgacgccgggctctcctggcggcgcggcggcgac
cgcggcctggaggaggcgcgccgcgcacggaccgtgaaccacctggcgctctccggcggc
cgcgagctgaccggcaaggtcgcggagcgcatcccggcggcgaccgagatcgcgccgggc
ctctcgaccgcgctggtccggctggacgggccggtgctcgtctcgcgcgacgggcgcgcg
gaggggaagccgtggccgggcgaggtggtggtggcgttcggcgacgcggcggtgccagag
cgcgggccgttcgacctggcgctgcccggcgggctcgcgctgcgcgggttcgcggtgggc
ggcggggaggtggtggacctgcgcgccacgcgcgacgggcgcccgctcgagctgccgacc
tgggcgctcctgttcgtctcgcgcgacctgcgctcggtggcgggcggccccgccgacccc
ggcgcctgggaccggtggttcggcgagcacggcacgttcacggccggcgagggcgaggcg
cgggcgcgcgcgcggaaggcgaaggcgctcccgccggcgctcgcggcgctgtacgacgag
gtccggcgcctgcgcgagaccgggcgcgccacgcgcgagcggctgctcgcgatccgcgag
gcggccgcggcgttcccgggggactggctgctgcgcgccgaggtggacgagctgctcgcg
ccgggcgccgaggcaggcgcgcacccctag

DBGET integrated database retrieval system