KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2897Help
Entry
Adeh_2897         CDS       T00326                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00430  Taurine and hypotaurine metabolism
ade00620  Pyruvate metabolism
ade00640  Propanoate metabolism
ade00680  Methane metabolism
ade01100  Metabolic pathways
ade01120  Microbial metabolism in diverse environments
ade01200  Carbon metabolism
Module
ade_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ade00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Adeh_2897
   00640 Propanoate metabolism
    Adeh_2897
  09102 Energy metabolism
   00680 Methane metabolism
    Adeh_2897
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Adeh_2897
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Adeh_2897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABC82667
UniProt: Q2IDK5
Position
complement(3270115..3271362)
Genome map
AA seq 415 aa AA seqDB search
MEVDGVIVLVLNCGSSSAKFAVIDAVTGRELVSGVAQRVGSAQATLDFKVDGRKESRLLH
GAGHERALRAVVELLDELGVAGEIAGVGHRVVHGGAKFSGSMPITPAVVAKIEECIPLGP
LHNPANLLGIRIAQELFPALPQVAVFDTAFHQTMPSRAYLYAVPYEWFAKHEVRRYGFHG
TSHRYVSQQAVKQLGLDPEDHAVVTAHLGNGCSLAAVRNGASMDTTMGLTPVDGVVMGTR
SGNIDPSIIAHMKKALHCTADHVMDELNRNSGLLGISGLSNDMRTLQEAAASGHERAALA
IDKFCYSVAKAAAGMFVSLGRVDALVFTGGIGENAVDVRARIVELLGFAGFALDAHANAF
HGKALRGRITRTTSPMAAVIATNEELMIAMDTAEIAAAHGHADAEAPAAVRRAFA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtagatggcgtgatcgttctggtgctgaactgcggaagctcgtcggcgaagttc
gcggtgatcgacgcggtgaccggccgtgagctggtctcgggcgtcgcgcagcgggtcggc
tcggcgcaggcgacgctcgacttcaaggtggacggcaggaaggagtcgcgcctgctgcac
ggggccgggcacgagcgggccctgcgcgcggtggtcgagctcctcgacgagctcggggtg
gcgggcgagatcgcgggcgtcgggcaccgcgtcgtccacgggggcgcgaagttctccggc
tcgatgcccatcacgcccgccgtcgtcgcgaagatcgaggagtgcatcccgctcggaccg
ctccacaacccggccaacctgctcggcatccgcatcgcgcaggagctgttcccggcgctg
ccgcaggtggcggtgttcgacaccgcgttccaccagaccatgccgtcgcgcgcgtacctg
tacgccgtgccgtacgagtggttcgcgaagcacgaggtgcggcggtacggcttccacggc
acgagccaccggtacgtctcccagcaggcggtgaagcagctcggcctcgaccccgaggac
cacgcggtcgtcacggcgcacctcgggaacggctgctcgctcgccgcggtccgcaacggc
gccagcatggacacgaccatggggctcacgccggtggacggcgtggtgatgggcacgcgc
agcggcaacatcgacccgtcgatcatcgcgcacatgaagaaggcgctgcactgcaccgcc
gaccacgtgatggacgagctgaaccggaactccggcctgctcggcatctccggcctgtcg
aacgacatgcgcacgctgcaggaggcggccgccagcgggcacgagcgcgccgcgctcgcc
atcgacaagttctgctactccgtcgcgaaggccgccgcgggcatgttcgtgtcgctgggc
cgggtggacgcgctcgtgttcaccggcgggatcggcgagaacgcggtggacgtccgggcc
cgcatcgtggagctgctcggcttcgccggcttcgcgctcgacgcccacgccaacgcgttc
cacggcaaggcgctccggggccggatcacccggaccaccagcccgatggcggcggtgatc
gccaccaacgaggagctcatgatcgccatggacaccgccgagatcgcggccgcgcacggc
cacgcggacgcggaggcgcccgccgccgtgcggcgcgccttcgcctag

DBGET integrated database retrieval system