KEGG   Acropora digitifera (stony coral): 107329885Help
Entry
107329885         CDS       T04352                                 

Definition
(RefSeq) geranylgeranyl pyrophosphate synthase-like
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00900  Terpenoid backbone biosynthesis
adf01100  Metabolic pathways
Module
adf_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107329885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:adf01006]
    107329885
Enzymes [BR:adf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     107329885
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     107329885
    2.5.1.29  geranylgeranyl diphosphate synthase
     107329885
Prenyltransferases [BR:adf01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   107329885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt ResIII Urease_gamma
Motif
Other DBs
NCBI-GeneID: 107329885
NCBI-ProteinID: XP_015750027
Position
Un
AA seq 245 aa AA seqDB search
MEIFAIGRHHLDPIFFISLTVAHKIYGVAHTINSANYVYFKALERVVSLNHPECINIFTE
ELLELHRGQGMDIYWRDSYSCPTEDEYKEMVQRKTGGLFRLAVKLMQTFSENKSNFVPLL
NTLAMFFQIRDDYANLLSEEYKENKSFCEDLTEGKFSFPIIHGIRNDSNSTRLMNILKQR
TTDVDIKKYFVDYLEQVGSFAYTRVVLKELEDKAQELITTLGGNPHLSAVVVQLSKLYSQ
TGGEQ
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagatctttgccattggcagacatcacctggacccaattttttttatttctttaaca
gttgcacacaaaatttatggagtggcacacaccatcaacagtgctaactatgtttatttc
aaagcgctggagcgagttgtgtctttgaatcacccagaatgtatcaatatatttacagaa
gaattgctggagcttcatagaggtcagggaatggatatctactggagagatagttactct
tgtccgacagaagatgaatacaaagagatggttcaaaggaaaactggaggactttttcga
cttgctgtgaagttgatgcagacttttagtgaaaacaaaagcaatttcgttccactactt
aataccttggcgatgtttttccaaataagggacgattatgctaacctattgtcagaagag
tacaaagaaaacaaaagcttttgcgaggaccttacagagggaaagttttcttttccgatt
atccatgggatacgaaacgactctaacagtacacgacttatgaatatactaaagcaacga
accacggacgtagacatcaagaaatactttgtggattatctagagcaggttggttcattt
gcttacacaagagtagtcctcaaagaattagaagacaaagcacaggagcttatcacaacc
ttgggtggtaaccctcatctatcagctgtcgtagtacaactatccaaactctattctcaa
actggaggcgaacagtga

DBGET integrated database retrieval system