KEGG   Acropora digitifera (stony coral): 107332810Help
Entry
107332810         CDS       T04352                                 

Definition
(RefSeq) polyamine oxidase-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00330  Arginine and proline metabolism
adf00410  beta-Alanine metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107332810
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107332810
Enzymes [BR:adf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     107332810
    1.5.3.16  spermine oxidase
     107332810
    1.5.3.-  
     107332810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_3 FAD_binding_2 Pyr_redox_2 FAD_oxidored Shikimate_DH FAD_binding_3 AlaDh_PNT_C Thi4 GIDA DAO
Motif
Other DBs
NCBI-GeneID: 107332810
NCBI-ProteinID: XP_015753035
Position
Un
AA seq 395 aa AA seqDB search
METIKSLLVLWLSLSFGASSPQEKKKVLILGAGVSGITAAKTLFDQGVTDFLVLEGQSYI
GGRVTQASFAGMRVEMGANWIHHSEQDDNPLIPLKKKNGLTATPSNYSRHIIRNDTGADV
TNTNLSKEWAVARDKLFEMGEANGKKDIPPIDVPATTGLEKLGWISDTPLKKVLSWSDIN
FQYGVGEEKASLNNMGAAGEDTFINDKKGVWSLYRDFYSNFHEKILVNQTVTKIKYNDES
VEVTTAEGIIYAAEYALCTFSNGVLESKMVTFDPDLPDWKKEAISRMRMVYYTKIFLRFP
KKFWDDSEFILHVSRQGTGHFPHFQNLDRPGFFEETRMLLATVTGDVALRIEAQDDSKTL
DEVMQVLRNMYGDGIPNATEFDNGSHRYVWFVKSR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaataaaatcccttcttgttctctggttaagtctttcgtttggggcatcatcc
ccacaagagaagaaaaaggttcttatccttggagctggtgtatcgggaataactgccgcg
aaaactcttttcgatcaaggagttacagactttcttgttttggaagggcagagttacatt
ggcggacgcgtaacacaagcgtcgttcgcaggaatgagagtagaaatgggagcgaattgg
attcaccatagtgagcaagacgacaatccactcatcccgttgaaaaaaaagaatggtttg
actgcaaccccatcgaactatagtcgtcatatcataaggaatgatacgggggctgacgtc
acaaacacgaacctttctaaagaatgggcagtagccagagataaactattcgagatggga
gaagcaaatggtaaaaaagatattcccccaattgatgtgcctgccaccaccgggctggaa
aaactgggatggatatcggatactcctcttaaaaaagttttatcttggagtgacatcaac
ttccaatatggagttggcgaggaaaaagcgtcgctgaacaacatgggtgctgcgggcgaa
gatactttcataaatgacaaaaaaggagtctggtctctttatcgcgacttttattccaac
tttcacgagaaaatattggtgaaccaaacagttaccaagattaaatacaacgacgaaagc
gtcgaagtcaccacagccgagggaatcatttatgctgcagagtatgcattatgcactttc
agtaatggagtgttggaaagtaagatggtgacattcgaccctgatctgccggactggaag
aaagaagccatttcccgaatgagaatggtttactacaccaagatttttctcagattcccc
aaaaagttctgggatgactcggagtttattttgcacgtttcaagacaaggcaccggtcat
tttccacactttcaaaatctcgaccgacctggcttcttcgaagaaacaaggatgctactt
gccactgtgacaggagatgtggctctgaggattgaagctcaggatgacagcaaaactttg
gatgaagtcatgcaagtattacgaaacatgtatggagatggcatccccaatgccacagaa
tttgacaatggatctcatcggtatgtttggtttgtgaagtctaggtag

DBGET integrated database retrieval system