KEGG   Acropora digitifera (stony coral): 107333658Help
Entry
107333658         CDS       T04352                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf03040  Spliceosome
adf04141  Protein processing in endoplasmic reticulum
adf04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:adf00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107333658
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107333658
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107333658
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adf01009]
    107333658
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adf03041]
    107333658
   03009 Ribosome biogenesis [BR:adf03009]
    107333658
   03110 Chaperones and folding catalysts [BR:adf03110]
    107333658
   04131 Membrane trafficking [BR:adf04131]
    107333658
   03051 Proteasome [BR:adf03051]
    107333658
   03029 Mitochondrial biogenesis [BR:adf03029]
    107333658
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adf04147]
    107333658
Protein phosphatases and associated proteins [BR:adf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107333658
Spliceosome [BR:adf03041]
 Complex B
  Other components
   Prp19 complex
    107333658
 Complex C
   Prp19-CDC5 complex
    107333658
Ribosome biogenesis [BR:adf03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107333658
Chaperones and folding catalysts [BR:adf03110]
 Heat shock proteins
  HSP70 / DNAK
   107333658
Membrane trafficking [BR:adf04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107333658
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107333658
Proteasome [BR:adf03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107333658
Mitochondrial biogenesis [BR:adf03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107333658
Exosome [BR:adf04147]
 Exosomal proteins
  Proteins found in most exosomes
   107333658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA Hydantoinase_A FGGY_C DDR CRIC_ras_sig AGTRAP
Motif
Other DBs
NCBI-GeneID: 107333658
NCBI-ProteinID: XP_015753975
Position
Un
AA seq 617 aa AA seqDB search
MPAPAVGIDLGTIYSCVGVFQHGKVEIIANDQGNRTTPSYVAFNDTERLIGDSAKNQVAR
NPTNTVFDVKRLIGRKFDEYSVQSDMKHWPFKVESKGGRPKIRVNHKGQTKTFSAEEISS
MVLTKMKETAEAYLGKKVTDAVVTVSAHFNDSQRQATKDAGIIAGLNVLRIINEPTAAAI
AYGLYKKKGGENNVLIFDLGGGTFDVSVLTIDGGIFEVKATRGVTHLGGEDFDNRMVDYF
KKEFKRKYKKDISDNKRAMRRLRTACERAKRTLSASAQASIKIDSLYEGIDFSEPISRAK
FEEINADLFRGTIEQVREAIRDSKLQRTDIHEVVLVGGSTRIPKIQQLLKEFFGGTKELN
KTINPDEAVAYGAAVLAAILKGDKSEAVADFLLLDVAPLSLGIETKGGVMTSLIQRNTTI
PTKKSQVFTTYSDDQPAVLIQVFEGERSMTRDNHLLGKFELRGIPPAPRGVPQIEVTFDI
DANGILNVSATEKSTGKESNIVITNDKDRLSKEDIEKMVKDAEKYKAEDDQQRDKVQAKN
NLESYAYKIIDKCKEVIEWLEKTDAAGKEEYEAKQKELETLFNPIITKPYQSAGGAGGMP
GGKSGGRDFTGAHAGGP
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccccagcggtaggaatcgatcttggtactatctattcatgtgttggcgttttc
cagcacggtaaagtcgaaattatcgccaatgatcaaggaaacagaacaactcccagttat
gttgccttcaatgatacggagagactcatcggtgattcagcgaaaaatcaagttgctcgc
aatccaacaaatactgtgtttgatgtgaagcgtctcatcgggcgaaagtttgacgaatat
tctgttcaatcagatatgaaacattggcctttcaaggtcgaaagtaaaggtggcagaccg
aagattagggtgaatcacaaaggacagacaaaaactttctctgcagaggagatatcttct
atggttcttacgaaaatgaaagaaaccgctgaagcttatcttgggaagaaggtcaccgac
gctgttgtgactgtgtcagcacatttcaacgattctcagaggcaagcaaccaaagatgca
ggcatcattgctggtcttaatgttcttcgtattatcaatgaacccaccgctgcggccatt
gcttacggattgtacaagaaaaaaggcggggagaacaatgtgctcatatttgacttgggc
ggtggtacatttgacgtttctgttctcaccattgatggtggcatctttgaagtgaaagca
acaagaggagttacacatcttggtggggaagactttgacaatcgtatggttgactatttc
aagaaagaattcaagagaaagtacaaaaaagacatttcggacaataaacgggctatgcgc
cgcctgagaactgcatgcgagagagcaaagaggaccctgtctgcgagtgcccaagccagc
attaaaatagactccctttacgaaggtattgacttctctgagccaatcagccgtgccaag
tttgaggaaatcaatgctgatctgttcagaggcaccattgaacaagttcgtgaggcaatt
agagattccaagttgcagaggacagacatccatgaagtggtattagttggaggctctact
cgcattcctaaaattcagcaattactgaaagaattcttcggcggtacaaaggagctgaac
aaaactatcaaccccgatgaagctgttgcctatggtgctgcagtactggctgccattttg
aagggagataaaagcgaagctgtcgcagacttcctccttttggatgtggctcccttgtca
ctcggtattgaaaccaaagggggcgtgatgacgtcgctcatccaacgcaacacaacaatt
cccacgaagaagagccaggtgttcaccacttattcagacgaccaacctgctgtattgatt
caagtgtttgaaggtgaacgcagcatgacgagagacaaccatcttcttggaaagtttgag
ctgaggggcatcccacccgcgccacgtggcgttccccagattgaagtgacctttgatatt
gatgccaatgggatcttgaatgtgtccgcaacagaaaaaagtactggcaaagaaagcaat
attgtcatcaccaatgacaaagatcgcctatccaaagaagacatagagaagatggttaag
gatgcagagaagtacaaagcagaggacgaccagcaacgggacaaggttcaagcaaagaac
aacttagaaagctatgcctataaaattattgacaagtgcaaagaagtgattgagtggttg
gagaaaacggatgcagccggcaaggaagaatatgaagcgaaacagaaagagctagagaca
cttttcaatcccatcatcacaaagccttatcagagtgctggaggagccggaggaatgccc
ggtggaaagtctggaggacgagacttcactggagctcacgctggtggaccgtaa

DBGET integrated database retrieval system