KEGG   Acropora digitifera (stony coral): 107335534Help
Entry
107335534         CDS       T04352                                 

Definition
(RefSeq) glutathione peroxidase 7-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00480  Glutathione metabolism
adf00590  Arachidonic acid metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107335534
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107335534
Enzymes [BR:adf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107335534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 107335534
NCBI-ProteinID: XP_015756041
Position
Un
AA seq 191 aa AA seqDB search
MEFAIQQLLLFVCLGPFAVQSTDLYSITVKDLQGNVVPMSKFKGKILLIVNVASECGYTD
QHYRELVQLQSKLSNDDFSVLAFPCNQFGNQEPLRNSAIARFVKNTYNVNFPVFSKVKVK
GDQAHPLYKYLYQNGQKEPEWNFGKYLVSKSGRVIQYWNQEVSPSSIRHFIEKHVNMAIT
DQYEVYRVKDL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgcgatacaacagctacttctcttcgtttgtttgggaccatttgcggtgcag
tcgacggatttgtattctataactgtcaaagatttgcaggggaatgttgttccgatgagt
aaattcaaaggaaagatcctgttgattgtcaacgtcgccagtgaatgcggctacaccgat
cagcactatagagagttagttcaactgcagtctaaactctctaatgatgatttcagtgtg
ctggcatttccatgtaatcagtttggcaatcaagaaccattgagaaacagtgccatcgca
cgatttgtcaaaaatacatacaatgtgaactttcctgtcttctcaaaagttaaagtaaag
ggtgatcaagcacatcccctttacaagtacctttatcagaacggccaaaaggaaccagag
tggaactttggaaagtatcttgtgagcaaatcagggagagtcattcaatattggaaccag
gaagtctctccaagcagcatccgtcactttatagagaaacacgtgaatatggctattact
gatcagtatgaagtgtacagggtcaaagatctatga

DBGET integrated database retrieval system