KEGG   Acropora digitifera (stony coral): 107335653Help
Entry
107335653         CDS       T04352                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase H-like
  KO
K09567  peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:adf00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107335653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adf03041]
    107335653
   03110 Chaperones and folding catalysts [BR:adf03110]
    107335653
Enzymes [BR:adf01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107335653
Spliceosome [BR:adf03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    107335653
Chaperones and folding catalysts [BR:adf03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    107335653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 107335653
NCBI-ProteinID: XP_015756171
Position
Un
AA seq 169 aa AA seqDB search
MAGEASSSISVSNSQNPVVFFDITIGGQDVGRMKMELFADVVPKTAENMRQLCTGEYRKD
GIPQGYKGANFHRVIKDFMIQGGDFVNVSVLLIFSKYTNEAISCANSGPNSNGCQFFITC
AKCDFLDGKHVVFGKVIDGLLVMRKIENVPVGPNNRPSLPVVISQCGEM
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgaagcttcaagcagcataagtgtgtcaaattctcaaaatcctgtcgtattt
tttgacattacaataggagggcaggatgttggcagaatgaaaatggaactctttgcagat
gttgttcctaaaacagctgagaatatgaggcaactctgcactggtgaatacagaaaagat
ggaattcctcaaggatacaagggggcaaactttcacagggttatcaaagattttatgatt
cagggaggtgattttgttaatgtaagtgttttattaattttttcaaagtacactaatgaa
gcaatttcctgtgcaaatagtggcccgaattccaatggatgtcagtttttcataacttgt
gccaagtgcgacttcctagatggaaaacacgtagtttttggaaaagtaatagatggactg
ttagttatgaggaaaattgagaatgtcccagtgggacctaacaatagaccttcgctgcca
gtcgtgatatcacaatgtggagagatgtga

DBGET integrated database retrieval system